# PaCkAgE DaTaStReAm NTLMtcpdump 1 2036 # end of header 070701aa129d26000081a4000000000000000100000001420b00f40000009a0000000000000002ffffffffffffffff0000001400000000NTLMtcpdump/pkginfoPKG=NTLMtcpdump ARCH=sparc NAME=tcpdump - dump traffic on a network VERSION=3.8.3 CATEGORY=application BASEDIR=/ PSTAMP=olhado20050210073636 CLASSES=none 0707011cefa5b8000081a4000000000000000100000001420b00f4000000b90000000000000002ffffffffffffffff0000001300000000NTLMtcpdump/pkgmap: 1 2036 1 i pkginfo 154 12153 1108017396 1 f none usr/sbin/tcpdump 0755 root other 895796 20329 1108016955 1 f none usr/share/man/man1/tcpdump.1 0644 root other 72169 27717 1108016959 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!070701aa129d26000081a4000000000000000100000001420b00f40000009a0000000000000002ffffffffffffffff0000000800000000pkginfoPKG=NTLMtcpdump ARCH=sparc NAME=tcpdump - dump traffic on a network VERSION=3.8.3 CATEGORY=application BASEDIR=/ PSTAMP=olhado20050210073636 CLASSES=none 0707011cefa5b8000081a4000000000000000100000001420b00f4000000b90000000000000002ffffffffffffffff0000000700000000pkgmap: 1 2036 1 i pkginfo 154 12153 1108017396 1 f none usr/sbin/tcpdump 0755 root other 895796 20329 1108016955 1 f none usr/share/man/man1/tcpdump.1 0644 root other 72169 27717 1108016959 07070102efd185000041ed000000000000000100000003420b00f4000000000000000000000002ffffffffffffffff0000000600000000reloc070701aa12a674000041ed000000000000000100000004420b00f4000000000000000000000002ffffffffffffffff0000000a00000000reloc/usr07070150d04927000041ed000000000000000100000002420b00f4000000000000000000000002ffffffffffffffff0000000f00000000reloc/usr/sbin07070150ce2303000081ed000000000000000100000001420aff3b000dab340000000000000002ffffffffffffffff0000001700000000reloc/usr/sbin/tcpdumpELF4 $4 (44BBB B |G G/usr/lib/ld.so.1me  !$&()*+-./012345789:<=>?ABCDEFGJLNOQSUW[\]^`bcdefgikmpquvy|~      "&'(),./123479:<=>?@BCEFHIJLNPRTUXYZ[\_bdfijlnopqrswxyz|}  !%&()*,.0145678:<=?@ABDEFGIJKPQRTXYZ[^_bcegijopqrsuvwxy{|}   !"$&'*+-024567:=ACDEFHIJLMOPQRSTUWXZ[\^`bd "#%',6;@HIKMPRTVXYZ_ahjlnorstwxz{}!#$%*+-0568;ADGKMOQSVW]^`aceghkmtuv{~    "#$'+-/239;>CHLMNOSUVW\]`adfhklmntz~   #%(),./1389;<>?@BGKNVY]_ac ۈ Lx\ $ / 9 F?E U4 flL v L E b8   Xl 0 I$#0 -Et| 7 D`C yM a q Dx C p  E, @    ը ! 8D  E E`l $ (- ? R [ x    X J  h  E EL    JxL 4` <6 N FV Xg p (:\   E  8  x ՠ  t@    E 0@ -7 EK T ] 8u`p}x R T Z  t ~ h C  D C   H C@ I(  : 0, (hd  $ 4 EXK x` 8r  X C( `h͘@ N    x&88 0 C7 HM Y EP`fT p  X|  x  D h  8$  ) G5 d D M _p e } C  x(P    F4  h  C   CL'Lt / C O g 8|   C  OH x E hh  H *^ :Fp` D N ` 8r9Pp  D9  d   Cp X_ 8 h  B&1 L= U G]] gt q ~   H ( h,h 4    H  &pl /c 9_x M jа  x   B `,   \  G" D$ F| $J 1 = xL x^ d 8s`x~   D0@ x F x ۀd   8HD # C1Ld< > HN x[@!`J0 nv yt   XN   x8 p  h F ( / 7@T D0 S$ ] o     H X bX%T d  F8   (( X1 H Q k s ~ r  C      5  l (Bl( 4 :Ȝ  C O U ^ DTf4D p ~X D `d  Eh:x   G4 8L  h  1@ + E2K` ?%H V f h~   x 6   X`  b$ 3 F D Nd$ Y hn @   `L t (h      x % 9 xL:$ XL n }   D  D h   D t@ (  C|( x4 8S YpD c m Hh  ( \ |     x(   h6 >< L d Fk<X z D X F (  83   H0   t4  X! (6Š J7p Zd l Dr 8L  oh LT  H E8  0< C  ( :$  & ը  .8 @  R@ a ( } H .h p  C E    >< ! ! H!+ !7L !H;L  !YT !cH( !n !~h| ! `d! $! P!@ ! qd!  !! 8! x" 8"( b` ": "EX"Q7 "^{l "h\d "u TX" b"x, " X" E"sl " X" E" D"` " Fp", ## #! h#.#5 H#C X#UP #c #q #X # # Et# #PL # $ $ \ $ CX$# F$0 B$5 ($J 0$R E$W $b h$y $ |D $ $ $ $ $$ X$@ $ h% %@%(%. H%B<\ %M <%\ %mZ %x % B %% % C%ިH % D% 8% %% <%d& 8& x&! h&8 &P ]&W &n \ &{ C&ٴh &T$$ & &rH\ & & H&x & & F@' G' ' ('2 'A 'L '^ 's:@  '}, ' x' ' 'h' ' t' ' ' (  (" (;߈ (E G(N$ ([ (k x({ ( FX( (` ( (5pt ( X( )9  ) )! D)( H)6 H)L )^ )g X)~ ) Fd) X) )O ) ) ) ) ) * *(X *1 p *H 8*Y@ *m F*t * X* * B*:  * *0 *8H *N$ * *6  + u + x+ +/ +B<p +I` +X @+b F(+h'  +s$ ++ + +< + + + G+ + x, ,.< ,< E,B X,X ,k ,|`, h, , ,x , , , ׸ , , F,0 - - H-4 P -C -Q (-c 0H-m - - - -@ - (- - . J. ." bl.. Cd.9 C4.@UH  .K OH.c .}q, . . .8 . (. F.H| . . H/ h/X /+=@  /< /SXP /]8 /kI/q 8/ C/ (/;X / /8 / / B0 E\0 _egpOutErrors_objcopy_argvgen_orgen_byteop_unix_objfreadfflag_interfaces_objnbt_udp137_printqflaggen_loadi_tcpConnRemAddress_objip_finddst_silicongraphics_objipsec_t_mapegp_acquire_status_ifOutDiscards_obj_nswc_objfn_printnsl_if_print_snmpInBadCommunityNames_objoptindllc_printcdp_printsetprotoentattr_type_ipRouteMetric2_obj_intergraph_objsscanflocaltimens_printatoi_gated_objgen_atmtype_abbrev_tcpOutSegs_obj_sytek_obj_ctype_ipInHdrErrors_objprint_unknown_datacloseinet_addr__xargvhex_print_with_offset_egp_obj_atNetAddress_objpcap_ether_hostton_cmu_obj_usmUserOwnAuthKeyChange_obj_icmpInTimestamps_objgen_inboundPrivate_ipRouteType_obj_emergingtech_objppp_print_ipNetToMediaIfIndex_objipx_rip_printfstatstrrchrether_encap_printvjc_printpcap_compile_nopcapgen_negpcap_set_datalinksprintf_snmpModules_obj_dec_obj_usmUserStorageType_objpcap_filenoopen_atEntry_obj_ifTable_objAflag_snmpMPDAdmin_objLflag_ifMtu_objobjpethertype_values_wellfleet_obj_icmp_objmktime_acc_objin_cksum_shouldbepcap_char_internet_objxflagpcap_out_sun_obj_snmpInASNParseErrs_obj__xargcpcap_stats_touch_obj_ipRouteDest_obj_ifInDiscards_obj_snmpOutSetRequests_obj_snmpInSetRequests_obj_rnd_obj_ifOutErrors_objpcap_nametoprotoudp_print_icmpOutParmProbs_objieee802_11_radio_if_printpcap__load_buffer_state_3com_obj_proteon_objpcap_nextgen_notpcap_lookupnet_snmpFrameworkAdmin_obj_excelan_obj_snmpFrameworkMIB_obj_apple_objfwriteread_infilewarningintoagen_lesspcap_dump_closetimed_print_ncd_obj_enterprises_obj_sysContact_objgen_mcodehard_msgs_tcpInSegs_objfddi_if_printtok2str_snmpMPDMIBConformance_obj_ipFragCreates_obj_icmpInMsgs_obj_icmpInTimestampReps_obj_org_obj_udp_objinet_ntoa_ipRouteProto_objinet_atonpcap_nerrs_davidsystems_obj_egpNeighMode_objpcap_open_livebootp_printllcsap_string_cheyenne_objbfd_printpcap_setfiltergetmsg_sysName_obj_tcpInErrs_objesp_printenvironpcap_getnonblock_hplanman_obj_usmUserEntry_obj_lib_version_ifInErrors_objstrcasecmpSflag_snmpV2_objgmpls_encoding_valuesstrcat_ifPhysAddress_objlongjmp_ifType_obj_icmpOutErrors_objtflagpcap_getnonblock_fdxid_map_hintlwres_printpptp_printpcap_readkrb_print_unisys_obj_cern_obj_ipInAddrErrors_objgetprotobyname_tgv_objopcode_iso_objgen_pf_rulesetninitiator_ifInNUcastPkts_objstrlcpygre_sre_printadd_addr_to_iflist_dod_objpcap_dump_flushudpport_string_tcpConnTable_obj_tcpConnRemPort_objmemchrendprotoentnewhnamemem_usmUserSecurityName_objvnode_baseipx_sap_print_snmpEngineMaxMessageSize_objdvmrp_printprint_data_ipRouteMetric4_objpcap_wrap_egpNeighIntervalPoll_objoui_values_mcnc_obj_vitalink_obj_ifLastChange_objfflushatexitpcap__delete_buffer_udpInDatagrams_obj_egpNeighAddr_objpcap_datalink_name_to_val_icmpOutTimeExcds_obj_epilogue_objpcap_datalink_val_to_nameContextnbt_udp138_printsnaplensmi_valuesgen_pf_srnrpcap_strerrorns_class2strtoken_print_udpNoPorts_objsysinfotelnet_print_nsfnet_objgen_atmmulti_abbrev_cabletron_obj_sysLocation_obj_sigma_obj_tcpRtoMax_objlevelsldp_tlv_printbgp_print_icmpOutMsgs_obj_egpNeighStateDowns_objpcap_lex_merit_obj_ifInOctets_objOflag_netlabs_objsmb_fdatapcap_closedup_sockaddr_finiigmp_printeflag_tcp_obj_ipAdEntNetMask_objpflagbpf_validategen_pf_actioninstall_bpf_programtelcmds_egpNeighEventTrigger_objarp_print_mib_objfopen_ifInUnknownProtos_objgen_pf_rnrfclosedltpackettypets_printmemcmp_end_reuter_objpcap_geterrbpf_image_egpNeighOutErrs_objfn_print_ssds_objarcnet_if_print_usmUserName_objz_buf_snmpOutGetNexts_obj_udpLocalPort_obj_ipRouteMetric1_obj_usmMIBCompliances_objstrchr_usmUserAuthProtocol_objnext_vnodesnapendbpf_optimizeppp_bsdos_if_print_at_obj_ipAdEntReasmMaxSize_obj_snmpInBadValues_objgen_ecodeprintf_snmpOutReadOnlys_objserver_msgsgetuiderrnomask2plenpcap_open_offlineSnmpVersionpcap_ether_atonApplicationprogram_name_usmStatsNotInTimeWindows_objgen_pf_reasonxid_mapsnap_printthiszone_egpNeighEntry_objbpf_filterascii_print__cg92_usednfsreply_print_att_obj_tcpConnEntry_objerror_snmpInTotalSetVars_obj__flsbuflex_initcookiecachegen_relation_tmac_obj_boeing_objstrerror_ipInDelivers_objhex_printpcap__create_buffermemcpy_tcpRtoMin_obj_egpNeighState_objmallocgen_and_snmpOutTooBigs_objpimv1_print_snmpInGetResponses_obj_icmpInParmProbs_obj_usmStatsWrongDigests_obj_castlerock_obj_mit_objpcap_lookupdevgmpls_link_prot_values_lannet_objasctime_snmpMPDStats_objpcap_parse_ipRouteNextHop_objlinkaddr_stringsunatm_if_printbpf_erroregp_print_ipReasmFails_obj_icmpOutEchos_objpcap_datalink_val_to_descriptionstrtolpcap_is_swapped__pcap_atodn_experimental_objstrcmp_sysObjectID_objdecnet_printpcap__scan_stringrelts_print_PROCEDURE_LINKAGE_TABLE_tporttableErrorStatus_icmpInAddrMaskReps_obj___Argvstp_printgen_acode_private_obj_egpNeighInErrs_obj_snmpEngineBoots_obj_tcpActiveOpens_obj_ubc_obj_auspex_objpim_printpcap_dispatch_networkresearchcorp_obj_sysDescr_objbpf_dump_intercon_objip_printtcp_printsunrpcrequest_print_ipNetToMediaPhysAddress_objdefault_print_ipNetToMediaType_objpcap__scan_bufferrx_printpcap_freealldevsmaingen_atmfield_codeicmp_print_get_exit_frame_monitorgetprotobynumbergethostbynamepcap__scan_bytesoakley_t_map_cayman_obj_directory_obj_ipInDiscards_objRflag_synoptics_objhnametableprotoid_stringsflagstrcpyenametable_dartmouth_obj__filbuf_icmpOutAddrMasks_obj_ipAddrEntry_objpcap_nametoaddr_snmpInGetNexts_obj_snmpMPDMIB_objigrp_printgethostbyaddrppp_if_print_snmpUsmMIB_obj_canstar_obj_iobpcap_freecodelane_print__pcap_atoin_usmStatsDecryptionErrors_obj_icmpOutTimestamps_objpppoe_if_print_chipcom_objfr_if_printinit_addrtoname_atIfIndex_objputs_ipRouteMetric3_obj_egpNeighInMsgs_objteloptsmobile_printether_if_printgen_scode_ipForwarding_objpcap_nametoport_usmUser_obj_ifIndex_obj_system_obj_nokia_obj_snmpInTooBigs_objegp_reach_codesisoclns_printgen_pf_ifnamegetservbynamelex_cleanup_nasa_obj_webstercomputer_obj_icl_obj_snmpMPDMIBObjects_obj_twg_obj_usmUserPrivKeyChange_obj_ip_objbittok2str_snmpInPkts_objdnname_stringtime_ipDefaultTTL_obj_usmUserOwnPrivKeyChange_objgen_broadcastrip_print_ipOutRequests_objpcap_breakloopForm_usmUserPrivProtocol_objpcap_add_ifCflagah_printgen_greaterNflag_sri_objstrncpypcap_loop_security_objdflagctime_cornell_objipcomp_printftellpcap_get_selectable_fd_ccur_objsduppcap_next_etherent_icmpInEchos_objedges_atTable_obj_tcpCurrEstab_objsl_bsdos_if_printputmsgfinish_parsepcap_platform_finddevs_ifSpecific_obj_santacruzoperation_objpcap_fddipad_icmpInErrors_obj_nyu_obj_usmUserEngineID_obj__1cG__CrunMdo_exit_code6F_v_pcap_list_datalinks_xylogics_objicode_to_fcodeegp_acquire_codes_snmpInBadVersions_objcisco_autorp_printstrncmpaarp_print_tcpAttemptFails_obj_snmpFrameworkMIBObjects_obj__iob_apollo_objmsdp_printgen_loadlenipN_printbeep_print_ibm_objeprototable_learningtree_obj_snmpInGetRequests_obj_tcpEstabResets_objatm_print_ifOutUcastPkts_obj_atPhysAddress_objpcap_perrorarcnet_linux_if_printpcap_dump_file_locus_obj_ipRouteIfIndex_objgetrpcbynumber_snmpOutPkts_objfree_usmMIBGroups_obj_nysernet_objltalk_if_printtolowerdopstr_snmpMPDMIBGroups_objpcap_inendservent_xyplex_obj_snmpUnknownSecurityModels_objUflagsetsignal_cray_obj_ipAdEntIfIndex_objhsrp_print_interlan_obj_spartacus_objvflag_nsc_objzephyr_print_desktalksystems_obj_tcpRtoAlgorithm_obj_ohiostate_objgen_portop_ipOutDiscards_obj_icmpOutTimestampReps_objmibrootdnaddr_string_icmpInDestUnreachs_objfilenopcap_open_deadblocksstrftime_tcpPassiveOpens_objrealloc_snmpOutNoSuchNames_objap1394_if_print_frontier_obj_init_ulana_objipx_decode_egpOutMsgs_objraw_if_print_prime_obj_udpLocalAddress_objieee802_11_if_printpcap_strcasecmppcap_nametoeprotofputc_tcpMaxConn_objisonsap_stringnfsv3_procid_snmpInTotalReqVars_objppp_hdlc_if_print_bbn_objsetlinebufipxsaptableClassfputs_link_obj_icmpInTimeExcds_objpcap_minor_version__ctypeipx_netbios_print_snmpOutTraps_objprism_if_print_snmpInBadCommunityUses_obj_snmp_objpcap_findalldevsgmt2localprotoidtablegmtimegetopt_eon_obj_sysServices_objadd_or_find_if_snmpFrameworkMIBConformance_objgre_print_0_egpNeighOutErrMsgs_objgre_print_1gre_sre_ip_printpcap_setnonblockpcap_dumptftp_print_tcpOutRsts_objgre_printns_type2strespsecretgmpls_payload_valuessmb_errstrxid_map_next_startuporttable_snmpOutBadValues_obj_usmStatsUnsupportedSecLevels_obj_usmUserStatus_objegp_status_updownmpls_printdnaddrtablesll_if_printldp_printatm_if_printarctypemapfddi_bitswapParse_fh_icmpInRedirects_objgetenvgen_proto_abbrev_ifInUcastPkts_objfprintfsigactionin_cksumffsgen_multicastpcap_leng_snmpEngineTime_obj_gandalf_objoptarg_fibercom_obj_allenbradley_objnetbeui_print_usmStats_obj_networkappltech_objipxsap_string_usmStatsUnknownUserNames_objvfprintf_ipNetToMediaNetAddress_objpcap__init_buffer_usmMIBConformance_obj_ifEntry_objradius_printsnprintfgetnetbynameexit_digitalanalysis_objversionreadfddi_print_snmpInNoSuchNames_obj_ifSpeed_objpcap_restart_egpNeighTable_obj_snmpresearch_objnbt_tcp_print_mips_objno_optimize_ipForwDatagrams_objgen_load_sysUpTime_obj_ipFragOKs_objbytestringtableXflag_ipRoutingTable_objrsvp_printobj_abrev_list_ipRouteMask_objsnmp_printGenericTrap_etextnflaggen_vlanmemsetascii_print_with_offsettrans2_fns_transmission_obj_icmpOutDestUnreachs_objvmapstartbufpcap_text_utennessee_objeproto_db_ipInUnknownProtos_obj_opticaldatasystems_obj_edata_ipNetToMediaEntry_objisakmp_printstrduptok2strary_internalcip_if_printtcpport_stringdnnum_string_ifOutOctets_obj_snmpInvalidMsgs_objgetname_egpAs_objvsnprintf_DYNAMIC_udpOutDatagrams_obj_ifOperStatus_obj_egpInMsgs_objospf_print_ipReasmReqds_obj_snmpInReadOnlys_objpcap_fileaodv_print_egpNeighIntervalHello_obj_ifDescr_obj_ifOutQLen_objllcsaptable_snmpInTraps_objppptype2str_raycom_objgen_ncode_tcpConnLocalAddress_objvrrp_print_icmpOutAddrMaskReps_objntp_print_environnfsreq_print_snmpEngine_obj_ipRouteAge_obj_usmMIBObjects_objsetjmp_tcpRetransSegs_objgre_sre_asn_print_ipRouteEntry_objpcap_next_ex_snmpUnknownPDUHandlers_obj_retix_objpcap_snapshotpcap_offline_readstrlen_udpEntry_obj_icmpInSrcQuenchs_objetherproto_stringdlt_name_ipNetToMediaTable_obj_hp_objabort_snmpOutGenErrs_obj_ipReasmTimeout_objchdlc_if_printExceptions_ipOutNoRoutes_obj_ipFragFails_obj_mgmt_obj_usmUserCloneFrom_obj_tcpConnLocalPort_objgen_arthpcap__switch_to_buffer_ipAddrTable_objmpls_lsp_ping_printsocket_cisco_obj_usmUserSpinLock_obj_icmpInAddrMasks_obj_exitpcap_major_version_nmfeccllnl_objsappendsafeputcharpppoe_printuflagpcap_datalinkcpcodes_udpInErrors_obj_egpNeighAs_obj_snmpInGenErrs_objstrseptoken_if_printnsaptablefcntlsctp_printpcap_nametonetaddr__fsr_init_valueetheraddr_string_baylor_objenc_if_printatalk_print__pcap_nametodnaddr__environ_lock_spider_obj_icmpInEchoReps_obj_usmStatsUnknownEngineIDs_objipfc_if_printioctl_egpNeighStateUps_obj_usmUserPublic_obj_ipAdEntAddr_objopterr_snmpOutGetRequests_obj_ultra_objllap_printlane_if_printwb_print_egpNeighOutMsgs_objpcap_lval_datability_objrewindpcap_dump_open_snmpEngineID_obj_icmpOutEchoReps_objpflog_if_print_udpTable_obj_ipInReceives_objUniversal_snmpMPDMIBCompliances_obj_usmUserAuthKeyChange_obj_ungermannbass_obj_snmpEnableAuthTraps_objabort_on_misalignment_cmc_obj_egpInErrors_obj_trw_objn_errors_pirellifocom_objegp_reasonsgetserventcalloccnfp_printgmpls_switch_cap_values_bellnorthernresearch_objl2tp_print_ifAdminStatus_obj_snmpOutGetResponses_objether_print_ifNumber_objisattypcap_compile_ipReasmOKs_obj_snmpInBadTypes_obj_usmUserTable_objpcap__flush_bufferpcap_lib_version_icmpOutSrcQuenchs_objipx_printnull_if_printspace_egpNeighInErrMsgs_objfgets_icmpOutRedirects_objpcap_setnonblock_fd_ifOutNUcastPkts_objsafeputs_ipAdEntBcastAddr_obj_GLOBAL_OFFSET_TABLE_setuid_tcpConnState_objlibsocket.so.1SUNW_0.7libnsl.so.1SUNW_0.7libc.so.1SUNW_1.19SUNWprivate_1.1libsocket.so.1libnsl.so.1libc.so.10 =(0*03 =(0?0Hy0R Nq0\ H`*I$% ըQ B B B  CD C C C( C4G C@ CLG CX CdF Cpb C| C C C CZ C C C! CM C: C\ D D  D D$ D0 D< DH DT D` Dl Dx D3 D D D D DC D Dp D D^ D E E: E [ E,  E8J ED EP$ E\c Eh Et EE E9 E E( EP E} ES E) E E& E F@ F F F( F4@ F@ FL FX Fd Fp F| F F F F3 F F F0 F FP F5 G @"`pD"`l"c, @' $+`-` `?-)#- =--% # @.@.#   @.z@j@ @.s@.tה a .+#` 333  ̀S@00`(# 0+#` ̀P@ @0"0 +` @`0* 0*"2 "*"ܘ `㿘@.B 5-װxo/ '@.@%` `` `'````` @9` `"#``  @.  @. `7#b  ` @. .2* ``|@-`$`㿠    /` . - ,`,  `` ```` 7` 7`7`@-Ò '```@ 㿠` `   .  (` -@@      *)  @  @7,, @  @-~6`66@-k &  @-Z @-c & ;@+b4㿠 `--`,     *`"  * `! @    @-&`6`66@-&  /@ېP @, @- & ;@͐bd㿠 # a /`  .- ,` ```@` ` '` 7`@,Ғ '` ` @"x㿈Ӑ ` 9   ?` :N / L@ /*  > M *  `M **@,&㿠`ˁܒ ``.`@,&'``@Mb 8!`H-  ` `K@-5  :*= L/   M/  *`㿘. -u7`IJ.`&-``@ ```'`%@> '` L@> >/ K@/J/J//@,'``㿐 ` 9 % H *     : N (+   = `L .``   M .``+ @+&㿘 1h. h'@/ @ `$@97$⨖@+˒ @+$㿠 `  `.`@+'` /!@u"-` 3` > M,` `M,``,``㿘. 17`".'.```` ```$`@)$`"̐ @+s@+b$``㿘. 17`!.'.```` ```$`@)$`"А @+H@+7$``㿘. -E7`.`&-``@ ```'`%@> '` L@> >/ K@/J/J//@+'``㿐@+ C;5ba  @+o.`#@,   @*%.`$,@ /`/ 3 b@*֖@*Ő$ @*$$@2$@*@*㿠;cx`!9u73#ĸxc|` /,$,`` &`&@ & `㿐/ //;cx  31cx#| 7@*m}`@*m`$` - `l 2   "  㿠;9c(@*h#43@Qϐ V@*@ %`@QĐ3@*U`dC  2  " 㿠;`` 9h73 h`|`,%,@ ` &`&@{ & `㿠;``!9E73!`` /,$,`` &`&@T & `㿠;à`95/&%"u6㿠. 377`cX/ '@.` ` ````'`@''`@5_'`@5q'``㿠;cc`  @&@) &`/@N\' & &x'D@) 'D @)D$@)D  $* ! # +`( * (` %.`@/ &.`- hxp(<㿠\  5 `1   ` r+g      ` `+g `2[  2W  2S   2O  M+g   `    :+g 6+g 3+g `   )+g   `    `  +g    +g@ 2 +g bH+@  & &L&    *)  (@&j70'  ?    (`,, @&L    + ** @ @0`(@& o&    .,`. @&=58'   & &L&    +* * @ @&&7<'    - &  , &    +* * @ @&L    .@-`. @&`D'  7L'   & &    - ,`-@&L    .* . @ &7T'  ??  .`3+ &   ** @ (@&    - ,`-@&L    .* . @ &7\' &L  & &    ) (`. &;`d'  @'Ӕ P@'  `   ,`@-+` &  '`s7l'    (@&  - &    ,`-@+` &L    .)  . @&L7p'  &   ** @ &    (`,,`@@&L    .+`.  @ &%x' # `  @'F  &L! &`&& 5'`;`' u a   W`   `     㿠;7aa'`7" #?   .` .-`3+3 ? `@'"Ё  $0<0000000000㿘!^!c#d!`i#\7##`!N!K!A!C!! `    "`@ " @ڟ*@  #  8ְ  #@ 8Ѱ @& !`޴!  !8ð !@ " @ 8 !@&!!+a Ǵ   @8  " @8 @&p     #@ 8  @ @@8  @&[  )    #  8  #@ 8 @&G !B!B  !@8q !B@ " @ 8j !B@&2!Bx   `8^  ! @8Y @&! h  " 8N  #`@ 8I @& X  `8>  ! @89 d@&   " 80  @#`@ 8) `@% !_6!_  "  8 !_@ #`" @ 8 !_!_@  @%\!_ `` ? @%"^;7aa'` m!7!# h@%   -@7  , 7ܔ  @%Ӑ@ 6 @%͐b… (53-j1/b# ` #ppF#h#lhl@%;``` @%;``‧ `‣ @%c!Ғ"#ҒbԀ'Җ+)+"c@%  ? @%x"^;7aa'`U-7%`P  * 7  (@7d   @%Z@ @%Tc$‣ (53-k(1/c,#48 ` #ppF#h#lhl@%8;`` ` @%0;``‧`‥ " +@%#c<  @ @%"^;7aa'`<-7%`7  *`7  (@7  .7 2 ҔbҔ '㌣- @+Җb.-6 =@$ڐD  @ @$Δ"^;7aa'` *7#` %   -@7  ,@7@$  5 @$X3@ @$c\  }? @$"^  h@$@ @$cl‣ (;/l731xcptc|# ` `#ppF#h#lhl@$c;``` @$[;``‧`…9@$O# ? @$B"^;7aa'` d%7$` _@$   (7  -`7*  @$!c@ @$#†(53-l1/c#㤸 ` `#ppF#h#lhl@#;``` @#;``‧`․ #@#c'Ҕ+)+# c@#   @ @#̔"^;7aa'`7a#    - ,`4   7/ܫ. @535c@#  @ @#"^97!!&@u57&`p  +` 7  * 7  (`7 2 / `2*+cD-/Ғ.`@;c(` Һ(  ,#@#T  D+ @ Ғc0+`)#-` 1-Һ<1/1@#@#-  @ @#!"^;7aa'`-7a" @(``, @+ 2  7)#ܥ-`/5/ҢD 1#@"   3c@"  t㿠. +7`cP? %?  <#n @"Ր` D. M(+t7 8% 7a" 8   @"` dh,@" P0㿠. -n6> % / @@@"qP7aa'`8 7a! @8 ``+  .`2`@"[`` #7%@"Ulaa$ @8 +7a% @8 5  T` /@">|{ ;7@"8`aa' 8q 7! @8k a f 7`3@"!`^ @"7aa# 8S %7$` @8M )! H `+@"`@ 771@! %86 7a'`@80  + ` @! # @! 7" 8 !7!#@ 8 % ` ߐ`'@!ɐ 3 @!Ð`܁XlXl㿠. 7 /o= Ԫ``-`@@+@!` !-@!!/@!!" &Ұ&a `l @!`"&҈&a N| y0@!b`" &Ҙ& `0a!] !HY@!D` "&&7 C)? !`;8@!#㿠 &`;Ҷ &a  ;  a|@!|,㿠. 6`&&a F:/o%` ؀;.@@  @ ׁ ! !@ ́ݐ #a@ Ɓ֐ %@ ϐ 'ː Ĵ@ Ő ) !Դ@ 9!@ 㿠. 6="6 `=`"$+3 `)p$ !D8' .@         @ eb 㿠. /h\7 > 6 -/`7 @ Pb$@ K0 @ E"@@ @bL @ :T @ 4"h = `  `#`-`,2`@ $bx      ;Zb@ &&㿐@ b  *(0X@⸁>`  '@&@ &J;'@F@M@F㿠  @;`   $     &    )@ ``    ; @a` `/` `/ &u$ @``@<@㿠  '@ې`` %`  9@͐!  / &  : @%@ @㿠 `` ``,`1h&` `@F @K  \9!,77@(@ @I\  `)7a@ !4@e7! @7"@`@@V   +  ** @ !L@@G  a`@@㿈;7a5l@67!" ;7a#@`ax@' 3ҞcP`"` @      (    #h #p   - +* @ #d```(`(`-@#l   * *)  @#t #\#a#`@Ϛ`  Z㿐;7aa@7a# 37a$#a@ Ҡ|`"  @    $    #\#d```-`-,@) #`   *` * !(#h   `@w`  㿠97!'$@g/7%7 @ 0@W %  X  * Ғ#< @C7`` &@  '` .`. -`@@+` ;bd@" bl@ bx@b@ b@  b@b@@h|㿠;7a"@7!"@ 7#@`!"@с+)t@͐b#$`=-@{6-@7@5@㿠9"@{;@tc  ;c@j㿠7& 85"  ` ` `' ` ` ` ` ``` ` ` ` ` ? ` ? `  @  ?#?@--`,@) *2 (20` 29 `29 ` !%@X  M"b1 1 `) ` ` ? `  ? ` @`? ?~@#d ` ? @#t ` ` ` ` ? ` `? ` ? ` ? `@`? `  `?U ?@Ґx ` `? ` ?S c|@Ɓ `+) ``? ?E@c@# ` ` ` ? ? ?.@c ` ` ` ` `? ` ? ` ? ` ? ` @ ? `  `? ?@c ` ` ``?? `?!@# ` ` ` ? ? ? ` ` ? ?@o `% `Ь`? `?@c#@_@9 `#( ` @V/@R@5@Kl L(㿠7aa%@a' 85 *`(0 ā aa #   ʶ   - @@@-- *2`) 0 27 `27 `)v!@ <&`"-@ 5# (`p@@H   @a  1  @ѐ X V @ʐ``]  M @l @|M    @ %@;  #  @ .  @`'    ϐ ː@`    @  +  @ @n`Ѐ 3`@g#`@`@7  @V9@R#@5@L8#` #\!!`!, 7``Ԣ`  ,`` p u```2`        .-@``  ` ` `  .+ "!` $  )@Ҙ  .- .@* * -,`)!@Ւ  '\ @ʖ ( ``0 `` 1u!`      .- $ a,5u)@~ .`2-  -,` a4@\a<\@| ( ,㿠6`  ;9a\!P``@f```@` ` `5h@T7`t@O ՞ `@㿠  `&``".` _ `@2  @ @U@# @ @I@a&` @ =!@  .-`5 @b @&'@,+@R2  @@a &`    @ϖ 9  ! @Ԙ㿠` !!@Ɓ &`  /  .6@ ` @/@`` ``-,@2 ` @#@b` ` ` @㿠;@b   .-5` b    - ,`4  W `S O `*@.6 "+ ?  / *` $(@Ƒ2 *@.@2 @U   .`@+ @2 \ 8@E   -,@2    ,@, @2 bL@/ #\`  , +` *`  *@, ) `223 @㿠"  ;. 6`@@ `` @9"@㿠97 !;97`"(@  @ &`:c`` '#c%Ғ``-.2@ɐ`@ /@`  5뀠 v1@"q@m@bi` #Ғ`b``,`+2@` (   '뀢( 7J%@E@A@}=`)`. -`2`@r# `@B 5@i` 8'``  [c(@] [ ,`@V0 ,` @Oc8@L@ `D``, @+ 2@@```.``. -`@;cX@1㿠 @-` <  <@ , ch@ <`<`7&`l@9#t@㿠`x@&`#@7a  797"(@. ` 3` `0"H3\;뀤` %'Ґ @˨ -7`(@Ɓ@ǒ ` @c   @#  +` *2`   @$ %  .,@2  @ @c     @K  cض @u㿠 #`!7@l"( N ` %@` ` `97"(:1 %  % N  . @F N  @A㿠  ` 7@2"(  @/`.4 ``@``@ ``- ,`3@`@`-``.-@e2 @㿠57 (`&( @(  `' /` ' ; "  ' * s* ' 1 : `' +`d ' ' @ ' ,U  '  `'  ".`@ @ "ɐ@ :Ӑ@ @ݐ@ "㽀. /7`ऴ`.e; '`b`]1 @u$V!@N+Oa BO ?O`#<(@x  -@- '`8@e *`) ' o+`# + ```'`'`@ '`!@>2O@!//ׇ( (`@`  ` ``  ` /ף+!$@+` ``` `` '`H''`D`!@٘@Ȑ'``'`8'` >7L!@Ś>5X@!@'``㿠;b` 13אa x /@97 |@㿘 @b 973@`!Ѐ;7aԀ`@ْ㿠  9@ `%*``--= ?b84a -' ```/``-`-```, `@+` *`  (`  (``,`@,` ` +`- @P`& 㿠ah@; &!@4!p`#ax@.)' %@Kሒ@$`+a@-/ .`@;a@㿠/ %@ %+}&`c  . @@'@5@݁7@ف9"@Ձ;@ѐb @؁@_v㿠@ @ " 㿠; b @#b$ޖ%,@'8Җ)"@@+bLƖbT@z-`/3bh@mt7|@b59"@V;b@R㿠;7aa'`!7!'`/h`\ %#8c@[δ @s`  ؖ :@(#8`T@GΠ @_`d κP @8`l  #\  8@  Ӑ`t  (` . - @ 5T@S @@2   *  , (@@3@   - -,@@@Ր    * *,  !V@6@Ð`  ! - /-ӥ,@'@R @2 @!    /` ) (HV@@5 @-8+@ap@)h \a@5@㿘7&5 0 ? @l  2 "  #@@ @- 1? #= ` ,;ېb̐@/ ?㿘#7aa&Ga# B $ a? @.   5 %@/  &@*@  ?@: ` /@  cҸ▐#\# bԐ  --4@`?㿘  a/ .`5  (< #\ #`   , @, 2@- - *.6#` #\   @    -`-   ,`* (3 @1@#@*㿘'7&>$`9 ` ? @  7 &'  @"@K  ?@c; @ /@z  $ - -,@@D`?㿐%7&L$ G '`X` ? @C  `5  $@4  %@/@` ? c: , Ӹ + %᧐ D  -#`-3#\@ ?㿠'7&"`8?  $x " s)  @ /`# 4*c`-` @0#\  +`'`.+. 3 3`@ $N` &K?# D#@ ? ` ` ``(`-5(@ ̔#&@=  `8`- #` %@@&%` `@s``- - /Ԓ&@g$  `?|<<` AIt$ !!'` - @@X&-h+7aa%@-7"@(1 `@i @A-h6+ !@7 -h7-@/(-h9#) 4`<"'@0@7`8@a# %` @3@  *` ! "  ` (`@(2`@ *`@   %`( @@ܐ# #`@ -`` -h@ÐD-h/7! !7!" @;@ P}-h@`Tv-h7#`};7a' @x-```) `(-` @`\-hX/@dU-h1@ pN-h7aa# U7a @P```|-,`@f2`4-h>`.+@Z`(-h%)7 ?!`(,#  '%"  ,` +,  ? ? ?" '@-%`@)`%`@% %``6  @Ъ%``ɬ-h/@-h7!!$ 97!"`@ ߇-@ -h>  (+@ `-h7Ӻ `40&@!  `4\@ Д%``-h17!!# !"`@ !```+`,7 Ӧ8#`L7p -@̔ a,@Ŕ@   /;h<@ `\ [1!T@V-h``# ^``'  Y ۸%@ t\ Հ  z%%` S% M%' E"A )@ I!l  ``$ `$`-@ 5x%   +@ ,a|  ``& @`! $% ޠ  @ ar ``"@ ` 'h@ \`#a@ W  )@ ! L `` ``&e@ ِ%  7 ``"`" %h@ ƒ\`aԐ@۔  ``%` @7h@ \ !@ / ``# v`$ q `!b@ `$``%^` `Y @ x $`$ $@ l"& 7@  %%e&_%`2W-?Q!d?@ 9"(H@ 1!d?@ &bTt@ !d?@ b'@ |c!d?@ p9"@ h`` @̢$`&@ "@ h\"@ M˔!d?@ ͐"?@ Œ7``#@@`#+c -h@ \  c4@Ȕ``! $`#@{<@ h`\cX@ $&$ W-h97!!%^!$@Y!``.`(` 7`ӢP' ' dpc@ c@`@ W`$&  @p%   %  I C% ,=!d?@ )?1#@ !Ք!d?-@ ?+c@ {!d?%@ p?;`@ h @Ѹ$ $ $@ h \  @@ MД!d?@ Ґ`H??`@ ʒ7&@$ $`l#h@ `\` @͔"$ "@ @ h`\1 @ﲔ $&@\-h> /`)@  Q-hM%'/17h7(ഢ, !   "@D" ?   #`(`(3`@z#\#h@h@ L"` $"\`""! '  (I!"U#`! !L!"#`"U # "J""~#` X `  u  "g#`  _ ` " #`s#\   *` * 2`@  \`%`#`b#\  (`(2@ Аa\`~%`    * *`* @+#`* 2 @ #\\`e%`     *`(#`+@ '! *&#h#lhl@ #\\`I%`#`#\ @ !,\`>%` #d#d #`#\#h  @a\dh!0@ r\` %`  #`!@#\   (p(`@ ]2\` %`#`a %`@o#\\``-h77# "%7$@! #h@ ;!`\`aА@P-h\ $  "  +a@C  X7aa#`  a#\a#7@ܔ 9@ !#@  "@ ډ@b@ @ #d3Ӵb#t\`x\#` #l  #pް#h"` #x $  Š\% h@d`@ t@ޒ`@ހ`1'`  )@Ӕ"@@  "v-hg'$"p-ha' b  %- *2@"Ȣ a@Ж   * @+2@P-h )#pcDcL /l  (,`4 '`@g؀6   `bx$ + *2@w a@r   *(2@Aޮ-hT%h@8\` )#t@M-h\`  /x@Dߐ#|@"&B\3ސb<@߁@㠁㼨57$#\'`\#`@ǔ \  *@-6 ,  ј "̸!d@ސc  @R? @@͒@@@Őc'` % / ,5 `s` p #h`##d#l#p #t " y# @t@Wh  . +`2 ` p l@d@q$`@ t @W` `@O ,0@K@ޔ+@\`#!d @44? @) H ? @`h@@`t㿈7'`@9 `⠒@ϔ ` @`|@    ` "!`؁1 "&a8``7@@! @@1# @`@'%@@/`@-@@ 9`7``"`@. `" )a-9.@-2@붒Ta+@밒a\,++`@ ) , 2@@w!$9@r!d㿠 / p-+ / ).`2@넒 ` @!`` ,+2@Oalh \@d㿈;7aa'`F#7a$ A+@ )aP!'@R@) "/"& "/    -@@ 5 @x;ζc; .-7!@ߒh\m@ i$`c$@^``=`%R' @M@ *` @=3" @7ؒ@q @b 耦%#@ 1$@K@@ 1%!PD@#@zb8@t 3@ob\㿠 7!!' !&! #@~␒@V `- `- -  $ m  $i;O)-@9"@63h`\`X  " T  P;   @"  ` @  @ " `7   - -- @@@ `   ) (`2`@"  c,`.2@'# @h\` %.`,2`@Ӑ  '`  `; J@   "   #  ; `57@4  $`͐  $;  !+@cD  %@  &; ` @X     "@   #` ;~7@il  $` , % ; ,`# "/;7@V b(@縐` &` y``&`(`Q@E` &` p``&`*`  #` \ l $ X; l`# "')7@& "(@爐`&` Q`5&`-Q@``&` H`&`(  "`,  " 'ΐ#@Ք @;cܐ@̔ @Y --,@c@ہ;7bPb(@ց@א@Ӑ@ϐ5@ː,㿈 @b7ܺ  "#` N#hb#\ :#d + , Y``ĺ`ƀ`<``! @`" ``b-+ 5 @訔 3@`'@蜔J  @t\`<```5<`9/ ̺"` -+ @1@X#}`#@Scx`@Ns` @I#$n`@D,i`@?c0d`@:8_`@5#@Z`@0cHU``7%7#LcT( `H$`<``@A   $ B`$,` @ %`/``~* 7cX`"(`# $````+ *@2  ` %` `%`( @`$``? ` b  l`2 s ia $`B7L"57777s i(l&p"| 717(  ( ݺ(`'``*@b ``'` Ԓ` '``-  7` b(i,   $ `$*`L````((-`@'ch@n``l@g$ ڀ scd   $ `$+`$```- ` *``( 'ɐ@>ဥ L7cp#x` B(  `% n %* @Ӧ`@@Ӝ$@ `ހ 7#|` (  `%` F``%`*`$```-  + 2`@逥 `(   % +%(`) %  %h) `%  %+ ```@# Ѐ À`b(x  ``%`x2 . :` .%`" :( `@`耥  ` %` x` :%`" + .+2Ԑ .Ґ : `@o`倥 }`= `. `4l;#`Q"`f; ( $`@y 7@T"(b  /7@n @K($`WT'@?P %7($`%  %`* @ `% @ %`-  -ؐ P@8c@   % o %d)  `@`  c@ -@@`5@77@(`` 7@ِ +Ò@Ր +@А "(@̐ "2@Ȑ ,C@Đ ,m@ ,@ ,@ ,@ N`@ Y`@@/@ "s@ "}@@ :㿠+7;@`aa'`̤ a% 7 a 3@|`(``& ` `7    0@e``"@  `#` 7   %'Ӣ) 8@H``&`@ `&7  ѿ9`@@2 ``! o `" k7  ѩ`H@ ``$`X `$T7   ђ-P+@```&@B `' >7 ` |X@``" + `#  '7 ` e!Ӕ@ؐ ```$@ $`%`7 $ O/԰`h@77Pb(@@@C0Xx$|Lp``` h`8㿈-H@7% ;#\$ %h \Ӥ `@zbP  7 d / ,`2`@m @[  #] "`@X`` .` `+``3 "!I` &@D-@(0`+ 4"@S;`b@(`+%a-  b@;``/@ ;``@;``&;@;``倦``"`*``(. @+@@);````* `) (@@ِb`Ā 7#"(@;`` @% ƒ  %+ @;`` @;``@n;``&;+c@;```-`(-2`@;``y` # @;``m``c$+  *``2@t;``_@];`#p p`$%#h#lhl@]c4`H````* <) (`@@L;``7cH`@D;``/`P@<;``'X@3;``@4;``&';`&#``@;`` cl@3;``@@ 7h\9\#t@;c@@;``= 㿠97!!'`!!'`: ,-`c̅-@&   "@ &` @    $` @ #  @ $"`,(`6   "`j` " e b$)#@N   #@T $@OM15+#@cĀ %``@z%  5 ! @0`-``+ @b  "   $` &`  @N%` @F: h ?㿠9"g^@@>>`%*` @)'#@)Ѐ`$  '`    @`  ?   *  "`` * 㿠  `-@`7` ) (`7````"  @ @`@ܐ  @ה-"' H`1  57"G.%)" H;?b#%@&# @' @Q ` ""```" "``""`@4   `@4  , @㿠` /7%@7a&! L@z   + +`*    G%#@cd`l @|'`S`'ߐ @SpG`    )  (  -`@-  + .,` @8|   * ( .`  ) @.-2`22@$``   -  ,, @@ @h`\  +`@*'`` /h\3`@'`7h\ 9'` @;`@a@㿘 ;c$ @  @ #a %$@ ' @J  )! 2͐`1@-@!Ѐ 97!Ԁ@ @% h7 G /?   -  + *  , @ , +   +.( 7@  / @ @  73` (` T@+` (  2 U2 +& @+  ( .` + $ ,$.` / 6@@F  /(%%(+ 3+  . , *@ @,aLa(!  a(aT@%`̤497!Ǣ'`;!7?a#\ U#h  F"(#` #d# S R P A   ( +.  @a  P@22 #@ + .`*+`@+ @   P@3 3 ?&@* @+` *` ( *@@  P@6  () . @ @P@6 @Ð!`/؀ /쀥 $ , - ..` /*`*   @2 `@ ( ) *+ +*`. @ 0` a@| ```+`. ) @ጄ@ 0@쀥  # , - ..  /*`) @@ ᜙0 @R ) ( **` +. ) @@ !@B˵```. `* ᤇ) @  @Lˡ1@F! $ % &*` '* ) @  3  @M$ " @.a ```(`+ (` @2 `@ y u  ) ( * +. +`+0 `  $ % & '. (+@  2`  & `&`*`  &  &*  `& &(  `& &(   & }&+  & u `&h+` & l &d) /؀  , - .*` , -*+` .@ /(*` /+` \ @2  @f```+`*` (  @* @+   *  * +` .`@ؖ@a74 P$`@Z Fh @V Sp @R Rx @N P @J A @F U @B /㿠`a@/ / ր@(@/ 5`8   @ ``h \ b@&&8`  @Δ `@`3@b @/@m`  S# &&  -` +,  /` 4`2 *    +  *`*`?2( 0&&8*'hԑ2 - )ϑ2 "H@\`-@T`/@\` 53@bdh@@ā@b$@ɁdDܝ㿈 5% / @@5@tbt   +   -  * /` 2  ( @ʱ0`-w2 -#\4|@R59@L   ",@.^2 @@3@=b   (@-P2 b@0+@,b &`  ) - >2 @ b@;&`@   +` *+2 @ c@ց@c    @Δ   +   /` .  7  (-0,@4 -2 #\c,#`@ߚ @&`3@אch    @    +  *- 2@ ,`4  *`  (0(`@-ʑ2 ,Ƒ2 .`#\4#`x#d@+@c@ρ㿠 ` ` `"3 `"7 /@ @~c 5@y @u 9@p  ;` @j㿠`% 9 ` * ) 0&````  -` .+,`3`5 a:`  @@5`㿠`% 9 4` * ) 0&````  -` .+,`3`5 a:`  @5`㿠 ` ` `"/ `"5 -@T @h 3@`p @x 7@ 9@ @;`@܁㿠   /` - @- .` 6 4`p"k`pK`p`0 ``/` " %D`@``%5 @  ,`.`3`,'$-(+`@/`@/  .(`5 ,@{/;`@u/  +`+ 2`Բ/@j+! @f`  - .`4`*$  /@V@Q` ( . ) 0;,  @@ 9@;!  ,`+`6a @0@, '  -@ -`5 - $ (@  !0@  ( . /`25, @8@ !!D@   -`,4`/P@   ` "@X`` ` `[ l@؁!|@Ձa@ҁ! @΁@ˁa@ȁ 9! "g;i#a@   , +`6 -%$ -()!@ +b@   ) (`5,@/@b@" @   .@.3 @ #$@9('0@wo)"8@qo  (@-5@ , @ ob@@`L@\bX@Xbd@U @   d# 0"#ŀ `# @?b99@8"@4   -` , 4`    " - " @ /@@bĒ` ` `"`"@@  @"@b@c@    . +` 3     " %` " )`@ː `'@Ɛ$`@#,`` ` `"-`"9+@c4@@ /@L@#Xcd@`p@|@   *`(@2 `@3c@~  , @+ 6 @c@sc@p㿠;c,;@ٍb9"@d㿠@@ . 9?7`> 3/@(b@ @1* 2 7#` ?#`; 7  "3` @? 2- "@ 8' `@ 8" ``"!: ` : @" @8 " 8   ѐ   㿠7aa'`s a&ma !: ` 9 @  #c  #  E # @  @ϐ'````  % 8.9 %(    (/(`?`@#1!1  " 89 #     -@- < ` @c 19 #@#@ 7#` *? ` %? `@ ? ?   "@ 8?   ` 8? "!:   9   㿠;7 aa ɐ'? %8 $    ``` ")71#? .??` 3  # 8 & 8z (`@"p #  8j & 8d ` @I`@c 7 @(@`2 5 @ߐ @֛2< @`% 7%(C"+ "8$ #  8    ` `"(`%"( "( .``"`.` @ .ΐ@ .㿠57'`@8 %   `@A"@  㿠-F7!!%@@7a'`;da,+ @~2@V* ( 0)  +@Ga; 5/@b-@:;97a(@8"(ߒ   㿠;h`\7b( b( Mb( `"`(Ò7 ɐ7 7a``" 1`$ ,  . ,`. +`54   `5@, ) @@@ېa<   dP. @/ 3@@ʐL`  &7"67D /"7) ڀ!7'"!7"h&7``&8 `%8 3@aX7(  ( ( ` "`* # h7 \ `( $ `$+`  `$  $-  `` `8o `&8j  7  ( * ( `@.\ -  .` -`,@9@!````*`*(@@d   . (`- @@!h```+``+ )   @l("( 1( ` "`+ ``$@8 `%`8  9 (`.`2`@ѐ!p!7!t( "@4" &  &) "(`#"( "( `"`+``%`8ϰ `'  8ʰ G 3 .  ( * ) .(`2`22@ax;a@z``# 8 `$8 `@, `+h `\ -7(%( ( `"`. ``"`8o ` "8i  ᐥ- ,`@32```#` 8Z ` &`8T  *  (2`@``  `8C / `,`"3` 88 3 .-2`@a``%`8) `  8#   +` *2`@a``"`8 ` $`8 % .`,2`@ؐ`@א @Ӑ U@ϐi@ːv@ǐ @Ð "@￐ @ﻐ f㿘#7aa& 6a`$ 1%   ,  ( (` /`@ +  - **02 2` 4      ` #\#\#`  $   / 9  <+@-!2`@Z!Ѐ;a@T3 7hb(\% ,  (`+`2"`  % ˒ % * /@4 נ$ a@`(%`7"("5`@ %  ,` %` `%`+Ӕ`@%  yh\`r`@.,$ 7"(@"c5`@ $ , % b%*K`@$4C5`@.,$!-7"(@"05`$ ,$ 3`$/`i`$45  $   !(, #  (= @ <.2`@gb  +  *`2 f @\" :` `$@Q`,@K`"4@Cb<@=D@7!"L@1 %"5`' `'  h`\`(%`7(ܔ"5`'` , % `%*`Ŕt` '``4l5` -+$+7bTb(@גX$` ,% e %/ B$` 4:5`.,$7 "("\@w"'5` $ ,`'` 6` '`+ ``$5bd@w5l@s@w ,9@s ,p@o ,@k ,Ґ@g ,r@c ,@_ ,ϐ,\lD㿠7"`` #`  ! "|&&`y-%h'@,x\`v@&m;+h3@b`\ f@i&];;b@ -@ @@&M;5@@`` `=' `" 8- ,, @@ "@]&';+@אb@ϐ&;3@͐b@&;7@Ð@& ;9"@츁;b@촁㿠;977c#0)?*v#&n i   /` + @   2  `2  2  @{& @B ;   <! 7*    * ** #  ## &    @A`Ȭ5@6 /@1 ?@+b  㿠+7aa&8T?a% N G Da &5h  * *`\(@ @L@#PT#h@`\`  (& '`:! ``%?`&?g@ܐ "   7@АD ?㿠? 7#px8``" 0`#  +    ` &``%`' %@뚐  @뒖& ? 㿘+%aa 5  @zn#7;!c#\ac#c#```` 8]?``! 8W?#d     ` ?& < 9  @  d@F\̐@?@: @5㴀`@0# @+cȀ`@%@# &  (d *` 5@   㿠;7aa'` #7!" 3} @c 1@#  - -,@@@ ?㿠;7aa'`/7%V3R @Ɛ` ?㿠;7aa'`/7%;37 @꫐` ?㿠  ` %@Ꟑ  `5Ӏ,+@ꕐ`(-@ꐐ8 // < @ꃒ?  11  D@w `9@s L& @ؐ`  㿈#\5   '? #d @#`!\;0  #? #d @#`\5870@ #d ?#`\\ #`#d #h +\d 9'!L-7#l$aaP( )) %0 (`-7 7a"d d  d " ' + ' (@'7!!`!  '7a#  \  &lm@` &` }`&`( `7" j7#` e1 !@Ē ` H7!!! T7" O +' @ 7!! @A7"`< + '@7!!! ,7" ' ) ' (`@'@|a 77`&` ` &`*h&F';a@e@c (@_ ) (HH(((((㿠77&`"%7$ )@?" ` `b @7 `3 ` ` ` (.@/`.2`2@(b ` ` ` 5" [")@b,`` `"0-`H%``(*-`B -`$ @"8` '!.`"8@@"<%@@ ` ` ` ` / . P.`@- 6`6@ہ "$;b|@Ӑbd` .`@.`8 bh@Ł"l@bx@轁`-`%X@` .`-'`@詁b@襁3b@蠁@螐 ` .`7b`@蔐@莒` @臁 @脐"`@b` .`"` @ub` ` c@n` !h %@e \@[#(` .`/+`@Rc05<@L ` ` (@/`7 ` ` `l#L,`+`3 * @5`%`P-,6`@+c`@'#a@#㿠;7a @ cl;7@b(? #  . .`-@ ct   ,  +* @ @@?㿠 97;@`!Ԁ !@ "5' %#@ @Ԑ`5 %+@̐` 5/- 1@Ē5@翐 @缁㿘@籁Һa &` '` %7 @6g.!! % Ѐ`#)7!Ԁ@ʿ@- `3 aЀ;7aԀ @ʤ㿠   㿠. !ӱ7`'!\ T`!8(/ 7  @/@ /@haheܰ `@ '@"_Ѱ  `5@@Ȱ # `5@I `@"P;h "H@ " @   @ N @ V% 7@"J/ " @)" G@" "d@ 1" H@9" c@"v -"d@n9$@{ @F ̘ ퟔ `\ 9 7@̒b( & @潐@   `2`` /9 @檐``&%& `R@@晐I&`&` 7 @5Z+aЀ2$ 37aԀ2 @ɴ @i  " 7@o@@h-  @;   ``O `@`A"!0 `!`"* ```"! ` !D@:aL@6T@1X@-!`@(ah@$ap@ ` `@`P ``"#+ ``""x `@ဒ `@! `@a `@ `@ᰂ `@!@㿠;b # b  `   .```5   `  .` @厔   @剁㿠ː;hǐ`\`) !@嫁-7Ԁ`/ض@堁 Ca@嗁a@咞㿈 @凁 ! &` 7  ` P*& @45=   !@Tb!Ѐ'%7Ԁ`#@Ȃ @- `3 {aЀ;7aԀ @c㿠   㿠 `?!& &   (8`&` `a`Ӓh@  #@b( @0 )@ "8@  /*   & `  `;`+ &` & ?`@א'Ӗl)Ӑ!p +` =@䗔b@`>/ &` c`) ! `a LL "P b\ "d Ԓl "t ܚb| "   L ##`    `   㿠 ;b  ,/@ 773b 5@0㿠97!Ԁ N'Ӷt+)+!xb@8N/|Ӷab@(㿐  +@ b;@b1@ #@ @ @# @  '@ @ -@ @3a $@'` `M``"L/Ҵ'``E@ 1R@$L+ *(@ #\@%`.' @43`5 `@Y '%#@㙐c,Ѐ+7aԀ &@ǒ@/ @5;aЀ`@ư㿠` ] X  R    K `G   @ <  8 4 0 a   ?(x8`@ *  ~:   *     ~@<     ;; cH@c8㾠` 5`@  " '%Ӑ@ `! @#h  } u" 9 73@c| @ߐ#  @ڐ㠞 @ )#@ҁ@ o;`41/-+)# cȦ#Ԁ  ]/` W`  ``Q`"8"5"20 ``  ` S ```@k ` ` `W `` ``@o``'@   /@b``L@U  +`@ ) 0 @ ` @Þ T@=㿠 +h `\/` -)5 Ӏ; ;55((   $@  l&`  #    . , @3  ` t)h \ &` + (@-2`@`|` d    .`'`*2`@ܐ  ` S &`  -`  - , @ @Ȑ`-` ?5 &`  +`  + )  @@ᴐ`*-3   ,  @, 3 &` @Ϙ@ &@`3"@ @`@ᅁ3`@၁㿠 -h \/``.5&`0 1 7Ӏܒ``` ````` `$`(#\`,#\@F` r! ``@;#9 @4'3`@-+ 5@& %-`5 `  K/? 1$   *  *)  @.@     5 $   -  . - @@a  !;   +  ** @ @@aa@'" &@`@ׁ!!,@Ӂ)!<@ρ㿠. `5h 1?#@"-;+%@ཐaDP@@ു@೐T@R9!`@ઁad@ু㿘  t@`ᄲ@!@ %31/Өa"  \@E&@#\&@@j$ 逤㿠  @U` @M@!в@E 931Ӥ!b" &@"&$  -@+2@)퀤 㿠)7!!'`@9!$! -@4 `&}  @x<@ c"D@s @@T@"`` $`[/ -@h+@ސb\% L ' G @Аx @> " :9  @߾"$ @, $(99+)h@߭b \5-@ߥ @Ĉ3@ߠb @ă/ @ߚ@ߘĐ  @W b@ߐ9"@ߊ ,  X x\ 0#7aa%ʺ a$@Ÿa !L(ƀ  &  #`  bӖb$  ę- (3 @#!d1  %  $ @87 `  ``l  `}  #@8y7  %@!d  @g  !  8c7  %[  +`" `8T7`  +  (2` p ,02  !@޿!da ,L2 b @ް!dR - (!d@ޤ  (`@* 6 = bL!d@ސ2 %t@ކ!d$ '@┪" !d@w  "  #    5`@æ  !d@Xf+b@Q!d@  `@ª  $@ "- d@}@l ` `**`3`< " !d@,4n5""")P@ @00 # , @ " ad@" $hcP@ @00 ! -" *`d @T@P@@00 ?&*3  @@@&5 `" !d@@ ` %; c d@ c $    %@J "Ep `% `  `*` `d-`+` @ݷ@ܠ$   "  " 87 ``" $c@ #\@ݐ!d  ; cp@݅!d  $   "- @s!d  `  ! 87*`,.@  %@W!de  "Ȭ  %Ð    +*cĘ@+ (23 @:!dH  $@  "87   - -`,@ @#\   * *(@#`   + * *  -  (% @*`@+ 23 @!d / c@6$0@ h\ $#/h  & /h $@7 * 4``/h ' /`@- 5`@A<@/h\@ `< 8 4 0 , `( $    ` )1@ܴ \ %@%!(,+2`@737d@ܥb(㿠;7aa'`J 7 @D`7@܍```  +?'5<*`* (@-@p`8   + *,` @ @.`. `Щ-`@4  @R5@L㿠;7aa'`J 7 @D`7@9``` +?'5<*`* (@-@`8   + *,` @ @.`. a-`@4  @5,@㿘` `7$ #` h 7`\ H,`/ 5@ג u'|#d)+!#`a#\ `e `@*^;"@ ]#` W9@ۮd@\@ۧ`(`/ 5-@@ 6  !@۔$a@ۍaЀ @#  &# ! @w -@p@n @ `@ca`@`3a@Za4@V㿠;@Ra耦` `;7aa$ @ a$8; a d p 6d-@ @0@@+b  "`e  " a;   -  ,/ @@R5@  %@I  E;  * ) 0`5/` @ h!@"$-9\`%7#%@bDH`5    %@ &`_ @Ӑ 5@͐L9P@Ȓ9"`@ā;bd@ھa@ں hXhhhhhh@Thh㿠;7aԀbl@ڟ+7aa'`83a&ںa " . 9@چ"t` -h`` @ `"@83 @nb  d  @f!@a"``$@ `%`83   *` (/ @ ` @D"`g@>ch``#` } `$ 8y3#@,b`O%@&Kh``%`e `%8a37@9h5@1h 9@")h@c`@h쨒h@ @Mzh hDh @ܐ#,h \``$@`$@   '  -@4- 6`@ٽ3/7cH(@ٸ㿘 -   @٨P 5   @ٞ\   l @ٕ 3? c  ,  + *  ) @ @@ #?c  .@- 4 3&%bu #\#`.@ 7/  @fx㿘!7;@_c! !& ;!% |!     , @,` &` .  * 6 2`(`@`#\ #`-``5 ` ( -` 3 <@'` D ! D"`? $ c' #  1# ,%P 3%`& &=  $``ƀ  c@ ;;97c"(@ց㿠@ǁ@Ð` $@ؼ`#` `!@خ 8 ;9`H;1`P X L`"%@ؙ  Ӳb,7570\@؇㿘  .& I`;7a  @? ! @: `     #  .` $@) `` `&%   %@  % @  & ͢@ `@  & @   `㿠```@)5+@%`p 8  &` &-x@ '``  '`& `@ 9@   `  a"![@``@ `@`@ `M )' ؀ 9 `Ԧ@   + +`+ @@ @Ò 쀧@*@+/`Ԩ @":  @ + +`*` @ס 逧@@ `@זༀ@29 @׏ > `:@ׅ5@ׁ㿠7a``#  `&`  # !``$ `%` `*5``&` @( 9@H      "$ h7. D""b7    "0X7% "0R7@"Y &@@!$IEa,@?a<;8@41H.+@!P`aT@!``$` `%  `/  /  @א\ d@єX9!t@ȁ` ` "`` `? ) :*  : :`* 2 * ?*`#3 3` 03` @ *2 㿐 `?`  :`@֌a;   9@ք!#@a'7;a@v -@o`-`!!@f) (0`%@@Y@7@Q7!?57&h%@`\/``,`7 n/@+@:b      @'b@#$@b,@08a @#@R\ , (`,2`@b<  / @+`2`@"d` t@x @"7a ' * 3` # -@,5 1b@Ւ@Ґb  2  2  2K H@ջ 2%    y  b  .  o ^ / g M  2( 3 7Z Yb p  g| l"{ &} & 2A & 2@&  2@/@ @0/@ @?/@ ̔@(א@Et~#h`\ R%@@he@)@JԒ@@' @+)+"@b@/7Ԁ` 1\@А" @57 @Ł @㿈`-@Դ@} >9`?`@Ԡ#㿠;7  a '`@ )#$'7@ԓ(?.+-2`@ԇc0?㿠 @M `  @G㿠9#D@m㿈cP@bِ#a &`ڒ 7&@#)! Ő`3-@3XaЀ;7aԀ@a㿠   㿠97!!'`@J!   @8E9 5  ,  +* @ @; `` (@.2@d   - -,@@% ``+` *2@cp  "`  $@ 9  `. -5`% @9#|@́㿐`15#/#\`#``#d`#h``@ӛ!㿠  / @-5dVdS dQdR"6+dU"#0+eS!';!a@"#)%+@ӌ@ @c@Ӂ@%@yذ@u@ #@nc@k㿠'7'`@ `9 &` ,  ) 0  "+-j3"%-d3@A@<# Y9$ T9 ; `(- .`ʑ2 @%+T`\/@,`1@ <`1  0`1! +  `.-2 @`@a`1-`- + @  %`5@ @`@Ժ`@`h@9 t@܁㿠#7aa'`@xa`" s   ,/`3` &` "/+a3)@Ҿ `Y``%@Y ` `U9   , /`  , +` @*@ () 66@Җ)`@Ғ `-  ``& , `"`@' ` . )  + `.    * -`(2@2@j2 `ظ ` @^9 @Z  "` `2  #  㿠9Ⱥ  x @ ``?㿠 +bg[@<; &@++`#",`=M;a,5Ȓ +/ #ȶ@a.5Ȑ@!a,  ,',!@!a,` ` * *0@ѽ `a,/ @9.5  @ѱ , x,`.`@@Ѩ !,"g _@ @:?`" (('@'!,㾠 @”!``?`1  ` 7 @ч . #Ȥ,``  @х 2  . 1ȭ.`!` @q 2   㿠77'@#7a$-+%cc `(   @r   㿠 `    (@-2 @9@U!`@O ? +` *2`( - `%@;+a@5 $@/a   -- *``1 @ `/` ` @7 7  + 7.-2`@a - @, 2`q @́㿠 `    /`.5@@aк`@ ? +` *2`)@Ґ  !@̐!  = 9  - 9.@-2`@л -`,`2`( @б"㿐3aHaH` @ @О#7aa#` ga`$ b@ ` +@Њb)"@І @@~ @{b,  @t"8 `@ibD `` @]P ``#` # `$@@m ' \@H``%`&   \ #\@  ;@; ;@&bh 㿘3aLaL``+@) +@bp%7"`E%@@$ ` * +  !@!"t@`  @W``% `@%@ \#\ @y` `;@Ґ ;@Ͻb 㿘7PP)@ )@Ϭ!'7$/7"`@ ` ` `"!b 3`"H\   ) `* @Ҹ" H ` ,@*`;@w;Ѹa 2   (* @`Ѹa   H+ H,@)@J)Ѹ!    +a@* - @#   * 耤 3@á;@ ;@aи 㿘;aTaT` @ @ܐa7!!" ##7a$ 'h@ )%`@ǐ!\ 3@ξa%/   9@ 9@Χ! 4㿐;aXaX @ @΋bx7%`'`@ ` &`&  &` !P( !P*@p5?@Z"|,@Ub`#@% @e `  !`-`!`-@E@0 @N @= @"b@G"5@Pb@ j`$|%@@wšD#  W- ƀ  b@ L`zb@ B`@ $:   @x 0` @Ғ '`U` #\  @’ `  @͹ =:`c4@ͬ `"' "$)'h#D@͠\$+@͙cL   9@ 9@̈́#P 㿘;a\a\` @ @q7aa' 77!! 2&`@ @]  !,`@ !- /@]/-h@G\`$`(5@=Đ   9@= 9@(#Ȱ 㿘;a`a`` @* @$7aa' 77!! 2&`@% (@  !,`@ !- /@/-h@0\`$`(5@< S  9@ 9@̐ @ 㿘;adad` @ΐ @̹`H7!!" ##7a$ 'h@ɔ )%`@̤ L\ 3@̛`T%    9@ 9@̄ X 㿘;ahah` @ @r``7!!" ##7a$ 'h@ )%`@] d\ 3@T`l%Ő   9@R 9@= p 㿘;alal` @@ @+`x7!!" ##7a$ 'h@; )%`@ |\ 3@ `%~   9@  9@  㿐9!p!p`@ @#|/7" h!7!# c@ `d@ϐc)'#@ʒ  aЉ* aЫ.@5@5@˲4 ;@@˥'#@ bP%,bP!(@@%@ˇc @+@c  5@x@@l̀` -`  @p@Z   aЧ(`aй) -@V-@Aj /"%bL$+ ` bL'(`-@3!@cG%bP$+ `bP @- @'@( "bT#/`bT$, @))@$@  @@ؐ`  @ѐ CU:^@(  ;` ")\4&` 6 Ҁ2"=' #+ `ӒT%!%"X@ʑ0+ #\ @4 + $@ +@z`L``7@ 7@kP 㿐;at at@n @Y`X37aa% P 7! K!@i  ` @A\`d@=/@8p` /`  %@<%@'|/-@"+@@` # "@ @7@  7@଺ 㿘;axax` @ @`7!!" ##7a$ 'h@ )%`@ϐ \ 3@Ɛ`%7   9@Đ 9@ɯ ā 㿘-7%`H7 `@C @   -|   ` \#\ -7D ` 9@w9@b ̺@;@\`к 㿐 ` /#`1\-7`ܨ # 7 @2@V" (# @ #@(  @"@#\`j@`"  ɦ&   , 9!D@ ` ;@ ;@` 㿠;c ;`9@ʒ # @Ȭ㿀;7a 3`@ԁ /h9@̐!\ \1``8@! `@Ȼ-  !@ȱ # @ȫa, @Ȧ!0  "  a4@ț @@ȕM:  %@ȉT(S%'@X   @r\  )@e!`+@`ad"a(!*^@Iah %`\)) @3!l `C/@-t aD(@!D*(@x% #aD,`+aD-/ /@ #\    9!@㿠;`2c4`/`$1,`977!  .#` 8% % 8  $@  3@ǟ@͐@  @@,``@,`3a@lj 3㿠+Ӓbl/-/p@Ǖᰀ . ` ``" 59 `" 9@~@@a@7@p! @l;b@㿠` +7aԀ`"(@U4@Q @'7Ԁ%H@E"T@@` 7Ԁ`#;bp@5-b|@0  @) 3cH9h @=b@ \ \  \@ z  ! @"@6 `+ b@     < c'` S '7 @ 7@ڐ`7@@ ;c @Ɂ Ր`@ƿc$@6-7ِ@ƶ $@--7  c(@ƪ7! 7Ԁ2$@`'`@ƚ4$@-7`m7a i7#c@$@-7`  /H&@``QOM @H B$  9 @ <`    +` *2`@Uct` <-+@m ? @hcㄒ@>3c@T #`@,P@(㿠;cgc  .'@  @@&`@`2`/````` '@)  #Ē`@@ @` '@/  ̒`@Ґ㿠;Ӵbt `@  ?@c     @#$  ?@ѐc    @+0<  ?@`    `@7HT  ?@ų( 㿈+`#h) #d!'"#`%#7`H#l`0#\a`T#p`<`$` ` *n1  #` f # a    +  *(@@ @ ? `h@h  @^  @2 ?@Ph `  @d  ?@C    `@`p  ?@6    `@\l  ?@)&      D@   㿠;9a;a0/7@3!@ %[7a%@V``"'G'&R 7 8 &  *   .`  *. ( ,`@@ @ڐ  &0 3aH `&  `,``,``+``*  `) (`@@ @ĸ` X@̔2   5 `@ĥAIt$\|\|||||||4㿐9/!`@-|+7@aa%97!'@#̲&`aT`.`@@&  /  * **  @@\᠀2  5  -  ,,  @L &ְ ͐+@Aa &˰  9; -  .*!L)  aP@#\\ 6 >#`#d`d@"  & 5P L!̤   `   / -#d-`#\\ 2 .#h#lhl@#```d &    **`@a &p 5 7@  @֐ $&` ' %#@<b@ƒ3 !`< @"XD@ú 1 "`@õaP!L )    **#d`)  "x#\\ $&#h#lhl@Õ#```d&$ $ # $b@2  @2   5 @s㿈%7&q! l> b@] %  8] $`@8X `!``--` @E"`' 8F & @8A `` Ӓ@  D@*"쀤0 cc @ &#  8  # 8    @y"  @$ 㿠;7aa'`1-7%`,% `# !./-`5  @c#@ْ <  + *2 "H@X  (@/ 6@8  x!7!!%! % . 6   2   #  8   #@ 8 , ,  `?5" 8z ,` `&@8q  @€ @L  #c`@s;ӒcH#Pcx@g@`@^` @>  `88  83  cܢ  #@=$  #  8  # 8   @  "   ,,p@@@@$$(`!`!!! x57$Z;%U; ` @c  .`4    # @ؐc   !@ΐ    "   "%@0  "   " 73`L@ h  \_ 1@@ x΂%`c` J(`d @ ]  @|`71S @s.1 I  )  ,+`,  (@-2@X 17. @O 1;% @F`1!@B / \@;t@Z #\ #`#d!(   @)` a@> ΁ Ϊ%`c` 8r;-` ŀ   9 !@   - ,`0(`6```% 8[;`"U/Ȓ " +@ ! ` `(@+`2@ېἐ   b @Җ` )"<@ $  $  ,4    7 D@  - * 5`  + 6` ``#` 8;`# #u  '@"  *  ) 2@bt @ @ $  $  ,4 O   ; b@h  cT ,+`0`  *`6` `` 8;`%  &    )  ( `*@ @  `+ (5@+`-23 @.$  *`*2  &`  `--`3 5@d&` @` @ cp ``(cx@ x- `,`8@  `<`D@#  `H++`T@ߐc  @`X''``@Ր/@Ґ  `d`p@Ȑ 5h`@Ⱂ@c\ #Ԑ@є $  $  ,4   ! 9 #@  ,`@- 2`  *6` ``&8;`# a   @ Y @y4R @r`L d@ $ ! $ ! !, 2=    7 l@V  ,@-`5- 6```# 8;` `    @6 Đ@K $  $  *4 tӴa#t#x! #pP#h#l#|#`@"x ``" R`$@M$  `+` `6# L ` Pp@t@ K &     "?  m f      M  *     0   *T M $    F  w ^   =        }   / E \`` ` s(` n}{h@C  $ n``$ @V@`#`@Q ```[ VP`` `>`! @9@$`?``"` '!`$`"-$d `@@*`` @ `! Ȓ@%@@!   @ $ `a $@ ḒP ۄ$@  !Ē> ɤ$@ ``% !`"`#H@a@aЀ `` ` `! @`Z@{$  `   ``# `"` @`<@]o$ ` ` (}  v4 ]@$i "@ bL9 J@$ i A@ $ M``#` 5`"0"8@1h@ bX  6:/!" `` `#   @  # b``"``# ` @Ӑ@ @ː)"@$ `` `%ܪ$@Ґ#(@⸤ ```"  `#`@ `$ ` `( `-`(@``# `$` X @w$ ` ``$  `! @-```*``,`* @@[0#xㄨ@Qcd`` g` @b# `@d `@<$@7$`b``"` J`# E#@ cOL``$ 4` @/$@ `6#-@/``#  `#`@  ``@$``"  `h` ` /@ؐ``! `#  $ ``|@Ð```"` `ג%  `=@ `` ʢ`#`@ Ŗ% +D@$ ̤````%` ` `  `* `-+ @ @% `!#/ `ठ ``! @ `"` @@a``# z ` `u  ( (`+`@  @J`` c` ^ * @+ 2`@7``"` P`! @K`$`*` (2`@#O``#`7`" 2!*@,2`@  (-`0`@/@lxl@ # a @$ @ݐa  ``%`"`#`)@!T-, 2@$``#  `# Ԑ"X@Ւ@a\```! @`"`! - @,2`@!@$ ``#` ` `(-`2`@w !``" `# @ ?@`$ ``a`` q`%l)@K!]$ v``$  ^`"Y``5;#@ O` J!  `H-@# `$ ۆM``"5`#  0((-@@b 4``"``$ ,-` @($-@H 9@"  bL@  h@ ,6#(1  (5  `9"@@ ԁ  " 3b\@ ;`@  ;17bx@"(  `    ` Z @8`: ( @"  Z @ :;  @(#@"  㿠? 9u77!( ^ M - 2? `' 0  ' . ' ,  ' ) `W  @ ' #  `' +` '  ' - ` `2 @- M@) -@$ ^@ 怦㿠77 %7( "( (( . #7`& +`a5 &  @ /7 & - 5537h @b(@ .#7@ @/7㿠77 @ 97#h(@ҁ    `Ӵ#x @c@` ` `k4` $ %` --@@57(`&( 7 .,",("7# @  #   #@jc"y7% 8s7& @m``@Uc&8d7 ^7 @F.['  O # @ K7``  ` `- ,`4  ; `; `.`-5`+cг6`@3 ' ! 8#7`    +` *2` + + ,@, 3c)@ @# 7/7h(@-7c(@7(@ .\㿠77 )'7#h(@Ӂ `&` ( + -&`j`(`c@`@ہ/7c(@㿠  9 #  @ 㿠  9 #  @   +`   *2`@|   +` c*+`  @m㿠 53 4/ /` .2@c@\㿠 5 /` .2`@R$`   %   -,2`@E(`/ @@,&` +` )   *c02`:`@*㿠   /` .`/`@  @c8    ,,+  ` c<@ 㿠   /` .`/`@  @c@    ,,+  ` cD@㿠^;  @ߐcH`; @ڐcP &`-㿠   /` .`/`@  @ĐcT    ,,+  ` cX@㿠   /` .`/`@  @c\    ,,+  ` c`@ cd@㿠 53 / /` p.2@ct@z  +`  @p㿠 !   /` .`3  .6`-`5 ,@[#````+ *`*2(0(`@Kc -@,- @6 1 , 3+` @7   *`((7`; .`5.@@%#,@+`,  3*2`* @c ` ` ` `(-.`5̥,4.@@㿠 !   /` .` .-`65 5 ,@#````+ *`*2(0(`@ށ㿠 5 '  #! /` .2`@А  -@- 2`@ǐb4 @  @` @`&` $4HXhx ,<L\xxxxxxxl㿠; 9 ` 1 -7 $ ' %@o  @ %.  *`2  #  р  #@  #) (0`@@B+  -2`@7 (@+5 `!   -`- 2`@#`(  +  *`2`@`4  @ @& ~ @D~    / *@ L(2  @$ @`H@T @ X`) ۀ.Z- ~T) & O) K) G) ҐC) > >) J:) & !5) & 00) & ܐ+) & &) =") ) ) ) ) +) 1 ) ) & ) @ \&@ `+ ``@㿠/7'`@'`9   *@ * 1 7 # @jh@h`       / +`3   @X   -@ -`2  @Kద   ,`+3`(7 @?ത   * (0`+ @3`   +` -2a!  @%@#   $9 &@  ` `` 9 ! @ ` `, @+ 2`@" z`$u +  .  -2`@`̀+! 8c9 "`]   ,+2`@Ӑ`#  O %J  5  ) (`2`@؀ `" 879 #  1  ` -,4   / @ `@@&@3 @5U`@  -,6 `; `p@3 `x@9 5 (@z㿠97!Ԁ  !    " - ,`6`@cs p  +   .`b -6`@P㿘9 "8@E ? #,+3`  +)  `' .@-2@Q"\  @( bh@" &` &  *@ * 1 %(7  @Ԕ7a `%! @"pЀ`#)7!Ԁ@#˃- `1`b!Ѐ;7aԀ@㿠   㿠 /  ? ,` *`  (-+`,3 0* 4@   *`(2  պ  aؒ @   @c b a&a b3h`3h^3h\3hcY3hW3hed &cNdK3h2d7E3he@3h>3h<3h ! -`,4`/ ( 4  (@.6`  < \ +  * 2`@=1 @6! 9  - -`,@@'!43h`\7 P@:㿠;7aa' 7% %   / ,`1  7   \.`@ .6`@h \Ԩ`\ Ԯ `w   'h(a-2@\  ./`4 $` ) 0  +)'`d x75 "@37a&     -   ( -.` 0,@** 32@5  ax!' @” %7  * *(ᬘ@"@@K'7$F &`$-5"   ! hhh$hh* @1 %(0`  hh`\  @mh \$  b @c, 3 x7% @:㿘 3  @.bА@c @ !  bT@= bTc@6 "@  2 ; @c  ޒB `B@wy   M&`  `  / @֐0  ܴ&``  2 `&` # # . +2`@ `  &` &- *' &3  @c@@Ò&`  +`+ (`#\-`@ڛ3` ?@"#a  q' mN@SP4E% @KL,-  P0 I* @-h/ @ \ ` 6)' "Ĕ `@9x  `  " C"  R  ?"  P" F ?9 9 @#D&` `@  %@c9; , @+  `2 " C"  R  ?"  P" F ?`88 -  - % @ &`85 8  &`@; cȺ @PlPl㿠/`- \4 €  ) "S )  €(;`" H "@ >`9 "3 1 - ʔ" 0` !,` Ā & &@ ǜ  & &@ @    & &@ ɶ  @uĒ 㿠57@/ @*`  `O @ @  '@?㿠;7 a@  / .`ב2  ?㿠97 ! `7`- ,`4 @` 3 ` ` $%@M``@%@?㿠77'`@Q '  L  -`,4`$@@%8<?    ..`-`@  ?43 &@`       +` + *` @` $&N@&?㿠!7!!$` !"` !h  \ @p(   ,`(4``  0@``    /  /`*@     .  * * - .3`@8 @^cԔ    ` @@-  `-(2`# @"`H C @P 5   ,` ) ,@@T    +` + *@ @`    , (+@ @@ @ p '  5  (@ +2`@|  +`@ * 2`@ߐ@ݐ   + -* +@` -/@' '@X5@w ``&@F `'`@   -`(4   +` + ,`  @    / ) (@    " 7 ? @~ ?@z?@v฀?# `@p8 ̶@``#` ``%   ` ` `* `/`-@@L`o ``$`Ӥ `# @  +  ( -*`@(` 7  d-@- 2@A`@  *@ / 2  `  a) ,2@*` @  `. /`2 ĒX @ *` ,`+ @  `G@ @ A @ @i@@ 6 ``% ` ``%Z ` +  /`5`` ` ` ` `*`+,@` `) ` ` ` `.* *(2`2@!g- ``,@ ,3   u  ` ,`(0    ``%` ``" ` , +`3 ` ` ` ` `*(.@@Na ` `.@+ 2`@E Ӷ@ ``-*`0` Ķ  ``% `!   + 5  (` ,+@ @ @     d**2@'a, @(  (* 4`7  *`/`2@a8 @!4@@ 7  (` ,/`@@ ,`) *- 2`2@ɐHX `* (0`  I    /`@+ 2`  6     ((`-    + +`*  P@@     --,@@5 d@p al@j㿠`/ -7x(@` 7a @Z"(   *  ) *`(`67` 2 % !h#7@Cb( \/h| ' @6/h+ )7a/h@1"(\  | 5 @$? 9 @ !  Y ; a@|||||||||||㿠7 /@͐pD970!!$v/7% @q  ```,``, + @  @"x 0 |@h`\.% @.!6 7 @␩5  @b `@  @ "9705 `` '@&@1; ,)`#$E>&.h`\   @kⴔ'@&@ ΁ "@bh\` # '@@Yb̲&@ⶁ b@Q; b@K㿠; b;h@D`\ 7 @Z㿠 7!!'`9 !&9    +` *2`%  !ഐ @`$%    /`@-5`ex9h \`5 @` } &` E# " d1 S"\/ ^1   @ސ#$ @ِc("@ Y#` T)  @ː#8 ,$,` B/ @D-h\`; @#P  *(" *` (` `'@+'`@cT$ @)$${$ ) @#`'`+ @ch`- t@ '`@'`#@'`i9 #@x㿠 `   &*`(/ @    ,` , + @ @]@  %   /` / -@@NL  㿀// `?` zǐ @e z @_  7 1 / #T7 @W X@S \@#7#` :"5  ( +`*@"``  ! ! #   * +`*@"`"   `  *) (`@  "``` ` "   + *+` "` #`@ٚ ! Ԛ +`(`)  @ "``!  #   * +`*@"`"  `  *) (`@  "``` ` "   + *+` "`#`@w ! r (`()  @"` ` $! @\#  X + *+`"`$  +` ((   "`(" @ ; !  6 +`(`)   @ "`,`,'!   ` ` 8 ` ` `* `* (`  "`0  ( (*  "`4   㿠 `'  @אl  +  @Аcx /  @ɐ　` 7  $ (@ , ;  0 4c@p; 'c;b+ c@Д    c *` - ,` @y   c- @q(   *  ؇) (`@c 5   -  ,, @@ +Ԓ`/ -/ @hԖА@>А@ O7#` 9  #  3   (` *+   @ & #`        (` (*  @    @8   㿠7 `'7!! "    -  ,, @ 2*` *`/7&@@ ;7a&@6 㿠7'`0 `+ ` "@" #@ 7b(b( ' @  "`' ,`@|  `'  " ' - @ "@ "㿠37 b( &b( b( `"`.@ (h (hP 0 p D (h@' $#b '  /   )  -(`@7 Ȑ@{  7   , , -`@@ ̖ @"  ؔВ @(% Ԣ @1@Β    , + -`@   )   (/``?@)-#I-@ 9 @#؁1 @#; @c(ߒ;" @cϒ+@ڐ2@ʐo7!!"7a&   .` ,, @ @)@ H7;a@`$6v  ! ` "   . , -`@@ @@m ,   %` '  ``. , `+ @* `-`) @ @@;@F`<%/7@@Lm$h?``' `` `@[```+``*+ @  @T h \_``&A `$<9). ) * @!@@ @ d``#  # `"@  ` ` `( *` /` `@, .  .  /  -  )  +` , * @ @@`l@_+@`O @ ?1 7@(gh\h \#7@o`aƒ``$ @`$  . .`/`@ /}1!$@h @@ h\(``%h``#  e`#``- .  )  @ -`/` - @ @h \\5h\0#@`Ȑ6`I0@`А&P9 @?'%7@ے(5)@͐ r;`97@"(77@`Vڀ'`` @҈`&`  -h  -  ,+@ @ \ + @a ``' `"`@``--``,`+ `.  ,@@]9@X!,=7 `{ 7a" u13h,,+` @4!< `\y)   )  ( /`@ @@!L@adH[B@ l8K2@t(ߒ;"@!ϒ ` ` ` . ` -- @@ӐaZ #7@Ȓb( ` / ` ` `* ) (`@ᘁH;'a !ᬺ!@a`  a  @  #a@#\ y6 +c|@ @- @@U -* @x/@q!3a@j5@d㿠` >4!+!dc!d-&@$!d-`@`$!d &  ` &@  `@      /`.`-`@&    ++`*  &㿠 91!h!h#Ģ` `,`%@+` : 2&2"  @ 2  @ܔ     " '`&& @6 `ͫ,?(Hh㿠+7aa&k a% f `   ** ( a   @ P# `@   -/ -@`-*`@@;@a 'c @!   @ "c @b ## !#@b$ $# ')@"0 $ & @ '  㿠;7aa'`(7!! #   , ,`+` @ &`" )7!Ԁ  /-+@jH@Cb<3&c  㿠/7&n "` h`   $  (` *`-  @@@bd ` ` `+  `*  ( @ /  +` 9 + -  ,` @-`@@"P + " @&@"pq `$ @ $'   *(`-` @ΐx`!  L#`      $*  %)  ( )*` &.`  *- , + ' +/  * @@@b@b! @   ( ) , -/` *.` .,`@,  + // @+ @z 0  1 4 5(` 2*` 6.@ , 3 7.`@, @@ @c" 8 9 :( <( =*` ;@ >-`@ /  ?,@@L~ D# ~ <$y    .` - -  @ + $+` % (*  )(` /` &, *,` ' +-+`@ @    *` * -`@ -   /`,` @#  ! ")  #( $* %@ &@ . '@-- @'@ ( ) *+` ++  , -( .@ /(` /`-@ϐ  D" T 㿘V2 ` {@ 㿘B2 `  ;h `\_ @ 㿘&2 ``  -h\@q37 37b( &b( b( `"`.@ @o 㿘`  -7 -7Ԁ`` 1h \5@H,h\@3   `7 4aa# | ` 7 4! @s`:#@'c4! @!#@` L@` h`\ "[ %@cX` @#d`  @p`( `1`0`2.`3*-@@@| ```/ `.`,`@,`. ` +`* `  ) ` ` `. `-`(`@`+` +`7`- `(`@ @@㈁  㿘H2 17 !Ԁ97 !!&( 7!` @# ````,`,`. `+`/  .@ @c``" ;@yć  㿠;@pcԐ    /` /  .` , ,  + *    )  (`   .`- @- @B 7#`@ 8& "   +  +`)  @  ! @  " `$  7aa#`  7! 8  * ) (` 2  `" T  㿠`;@c` 9@ؐ Ł㿘g2  ޒ7" 57#`@ 81 ```. `-- @`` ` 7h \ 9@  㿘 @ 㿘 h \`!@h T2 `'h\/7%8 77`&8  `9``@C 㿘В3h `\ 9h7@/0 \2 `7 !!! 0t7a#`0@ p ```+`+``*` ` @(`` (`-``- `.``,``* `) `(```` 8``.-@- @h\"6 `` ``/ ` .`,,` `. +  !@Ő`l`L `(`)`$`%. `*-`&*`@`') `+- (`@@   㿘89h  \`@`h`\2 7 #` [7" @V`` ` -` -,@` ` `+ `+`(`@@ ```,`,+ $```(``/ . (#\4#\````/ `.`,,``. + @-  0tPl P < | $ $ $㿘 `? `.`%4`.`! @`@)@ ؐ-7Ԓ ` 3@ڐ`  /h\J7 aԀ  ;@`ؒ 3Dh`\"@ h \`mh\ h \ @a9h \u`bX[Q@uFA#h`\!h%@c  \O4 :1  ( (,@@@@N!(@Ia0h @9!<X =Đh\h \77# `%7" ```+``/ *   @D`  /` (`-@P@7h\. #@aX P%7r !h \ +h`\ %    + ..  @!`h`\$ %`}/ - /` *) @ @@ @lh  \˔ ka5@tW  9h \XNŐQG@la|=  h\>47-!@R!q#  7h\s$Ԑ#@7aV%h\Z @&aE  'h\)@ !*܀  1h \{+@a {h`\@ݐh\@Ԑa h \^@ Lh \9@!h`\~!@!h\~t/wm#@aܐc  %h\dZː]S'@xI)h \LB+@ga8<2-@Wv(,"/@Gf3@7bV7h\ #b( 7@%"(;b@(@Xp㿠`0571@ "0' )$@$73b(``8=@b<` ` @   D@L@`ch ) @@T@ݒ*\@ג$"h@ђbt@˒|@Œ1"@ 5@!"@  $@Ψ` &``@  ` "```@ `@h`\   $ 8; $3b@{@  %`` b@k@  " `  " b@[` >   ! ?@C @| ib@5i7@.i5@(  $F` %`8B;& B @&-@s  " /` " *@@c  #` `  $`+c@@  % `( %@ 5@@;97c "(@ہ@ې @>A.   *@ ) +` (0#` ` (`2`Dƙ( JN#\\h@C0A=AeA ;   + +` *`  . -#\@a0a0- *\ʍ$%ƅ,ζ^# Pҵ4V X9؅\#\\;@#\5 ;\@c0;h@_`\ 9 ꟴ"/&'@Mc8|@z L@J|C0A=AeA㿠```.`. -`  , `@+`*  ( @ ( ,`,`+` .  @ `o)7''"(`  @$&`#\`  $@( `  #\ $#\ $@#\\:ځ<=>Rԍ6 Dƙ( J N9΅P#\\`@#\; `\ `"`  -`"`. !`"`  +`!"`(#T@@ -!@ +!㿠;b`)#\@/9    - "/7 "57+@cd9@~h9@zl91@u#t 9@q|99@k#@h㿘  `+@`c @' /?' #??c0++` 2` ')! '``` ` `"-`"-Ґ ΄ ~S   `1p!Ѐ97!Ԁ@y? 㿠97!!'`!  "?  .` /`2` 1?"@   $`q  % 8m?gb  /   + +`*@ ( @ⴗ.2@Ř&`  "`@O  $8K? $    , @zҒc, b @z˒#4  ' ( ( @ b,@z#\g < @  $@  % 9!l /@zx1@t#d?PTT It$Ad  T t tt0t㿀L ? " #\- #  g, @7aa$ Za$`Ua!   +@zh㠒@"c" A$< % 4#` /*(2`:#%` @#"  ` `` c7(`2_7fpfm @#$fdfa@ԐcfXfU@Ȑ$ fLfI@ \  * @+2`@ `  @"   - *2@    +@ ' /h @7aa%a&`af@vԦ``"`"e1@a  /h7!!$y!# t!eՐ@I"`@h%c `! '?  , -(`  .@@,!a/h]?(+#`B$`=  +   *) @@0@ :/h-7#`!$`  ? /  (` *.`@-@@</h?aL#9# $  )  (*`@@@6 @ /h7$ @ % Ԡe51@!`  $`Ȱ '`À ?!p᜺' c%  %@     +` + *@   3@w @/@pa@l  @    d@X  "w  #` r  d@D v/h/7p% @Y %T    .`--` @   #d3@a d%@    *  (`/` @a 5/h 0\ -b<#d-\#`)"H'9+7L"a``! `$ @\ ` ` ` `- @``+#h* 5*0`\@w#l%d@–lh&#\" h'-Ȁ P ``$``! @Đ  ` ` ` `,`$ #h-(`@2`+ 2@w#l@``$`&@lh$` 4+ @ `  ` `- `*`#h(`@ "@e#lhl1<#h!c#l ` ` `+  `*) @@O"hl`#hc#l ` ` `)  `. ,`@@9bhl<#hc#l@-hl< ` `# ` `((#h-@#pp $4#x#|x|@#lhlݯ<1 #   (+#h+ @   #p`p $,#x#|x|@#l`hl< `# ` `+  `*#h* @ c0@#lhl< `/#h㬒cP@w#l `@ɐc<hl< `1 #h【##@v#l!@#X# ``<`@vԒ@ hl ` ` ` `((#h+`@ @ #p p $&#x#|x|@#l hl`Y< `1 #h#!@v#l `@}#hlI<< `/`9 ` #h@j#lhl`4` $` `` )  * #h(`@ @U#l`hl#h@L#lhl`<h\`#h@vW#lhl<< +  `@| 7\3b@ &7``! ;`"`@6#hb#l@ 4hl\@ \#h`<@v#lhl2\\`@!/h9"d@;b@\ #h`\  %H@u\/h/h\`1 P@u\@88㿠 7܀l-ƀ- %l97@uh 1@ X!!%8\ !%`@8V b !  p``,`) `(.@- 2`@}@ "` 86  %`@80  a @g" 8  % 8 `" aݐ@Q̴@K`쀦&%aÐ1@7!  ;7aa" 8 a #  8 - )la@u`!'@ ` `#@ 8Ѱ `` 8˰ 9`7"@uI8 @!$h\``?`?` #%;a@/7hb, ``$ `# a`   *` (-@t   +` + *  @   *`(-" ` @t̐x   *+` @p  a 1@!  M -7%`8F 37 a&8?  +`+ * @ @` !Ԕ '#'`̐@g` " @a   O?  J?   +@Da̰ 㿠/7'`@۶ ' 9 (@(`5&`"`%#  $ @a)@t9!'@ L`u9h \` ` @9`+` *2`@ ``.@ , 6`@% ' 9`c@אb&`s 8o9  `N@b(h@b4h\`I#` U$ @P  / *@ * !2@sǒd  (.`2@D -,4` `` @rI @"l```-`-`,`@@rbp` 2 9b@b957#\(@]㿠 ,?`()@Q#l 9`(39`,cx@H`#h7`@sg5`1@s`#/`0-@sY+`c@/㿠  1@'#`-5@  `@7aa" 4+7!"4 & `  '@^)Ҷ$! -Ѐ` 57Ԁ @q;@ݐc㿐77%`k % f `b    ,(@@) (`03 `R%_@@  . * 6` @@r `_' +_#  ` ?@    ) (+` _  %@(  ``  `$`  `@`(`,,@j  $` '`9h \`7@Y8^ߐ@S`<  ` Ξ  +h`\ /-@AP@?T %h *@ * @r2 \  '`@  &@````!#Ժ&!#dԺa#h?#`#lԸa!a7#` 7! ^'7%@d% @t7" n`-) + "7^f+@ې`p7!!$U/7"@ O`t   ,) @(`5+ 3@3  @7aa" /7!" *`l`@2h^! ?`#\@@Өd& #dz7 @} 8h㿠77c%`Y`& S5`䀢`A*` @W  @&`#  ")h`<` ` ` !@=`)h@9` )h@3)h`:`@- )h \&`@` & @` 5` ) (`@p2 @ @ a#` `"`8;]`#]`@a+@a,% ݬ` %8;]m`9]i@ݐ!<@ؐLh`\&``@̐X h \#` `$ 8;]B`9@!h` ` ``-.`-`@]/` 1@!t])` @!x``(@.@p|2 {@a#  |`$ 8x;] 1]`@|!` ` ``/ --`@\` @ia! T`" 8P;` 1 a$Ԓ,`!``+ `*``)  `.`--`/@@=!"!@8!h\``X&`%h'@+\``L&` )@ !+@a`>` /`>@;a@ 㿠#7aa'`@֢a`" /@ ``" 7 @ @"@``$@ `& /`` $`bt  @;bd7@ɐ(  **`2   9  ,@+ @o2 @"0 71Ԩ4!0&``%@y`&`t\' @"8`` @h `" c  `  /@{@ @wH 7@rP@n"X   @f`` `3 `! .  $ ``" #`#   `2[͐  @?  , @7 $/@+㿠97!`> +@b@`-`>`@㿠;7aa&8?a%Ā`a"  # 8? 2?  ?  `7Ā #?cĶ `&` ( e?$@ _?% Y2X[O3@Ðb&J? D[: @"   @b .,` @b& #Ԁ a8   ++@b 5 -`@y@w`?p@ ( T㿠;7aa8``"@ ј`%  % $Ā#!@H" b  ,  ŀ 9@;"9 '%?T!P``" @`&  `.`` * 2`!`#@+-1     ! . "Oh[ zh    "7h+?a逡" h+@  +-@m‘2 @ڐc@֐ #,@В   + -- 5`+ @2 @ (82.@:`7   - -`. @ @ @h@c@c@z   +` . *  @k -  )  .+@@v\ @p `@j @mM  -+`6     ((`2`@V# @S 9@O5 `,@C h\ `@7$ +@(`0@%`4 h\8@ ;h'@L`\   7XԒ\ @Ԕ!`##ad@`Xr `;`&`@`P d `9 @)@ݐ pY%@ؐ Ŕ ! @΁@I'@Ȑ  @`@   7 3 9@ @@` ` #@`  5@@    -  ) 0@ `;@}`!?#@'@v`@lX`   @9 @g TT@@L    *`(@+*3 3`@M  a@E2*@`@9!(@6 )!4@.@+@a@@/8@5 @3a@7@ @D   (@+ 2`@Pv  @!X o'  @hh%@tԔ#a|@݁;!)a!!a O @͒]W3@L@ >ἰԶ 5a@'@@ *`(@k|2 @ @ ސ-@@~!@z@x  5@na@k9!@g3@ca!@^" K @T@#@Nb  ; @5@C` ` - '@8 `  ` `. `*/`@*@@*" ` ` `*  `(+@@",@'@81 @"T    @ bd@p   (@+@j2 x @"|  b@ i !"c @Δ  V ;b@΁#@ːb@Ȑ  @@"  %@@b  )"@``%`&  @"(@.6 @js "ز `@;b@L    hhhh؝㿠7【@j@g'7%`""`@`a #`@juc@K```$` `% /  +`4 ! !81h- /`` @`!   + --  @``"`Ѹ` `   ,. @/# btbp&0!    ! "  " 0 !" -0+" % 0/|/``#``%` - *`.2@i֒  (`-2@[/X/``#  b`& \#  - /`+@ @c?/ ?@?"A;C1 !"3=1!@m <)@h ``$@: `' @861 ` `5`3 @Q` /@L@H@C`@?@; @7`@3 ``%  `' @50 % ) (`2 @;@a1@!``"@ ߘ `# !    .--`@@!`` `@Ä `! ;  **`2`@ސa``#  `$  cP`#.`@'@Ð$)@!0+@a<-@H9@!P~/@Xy 5@`sp``! 8r1` "@ k  +@+ 2`@xZW``$X `%`S)  #lG,@-@p|?9@k!:7``&`8 ` 41S@U$ !``"`" `#   a#\     @; !@6!#@1aЁ``@,1 @&!؁㿠`#a@`/7% -7 `7@37aa& ;a" a` `.` @  "@  $`/ @ސ  %   @; `` `/``. 0&`&``( '@ (M'@& ``  #` 8a; &@[``&&O'@    `J E   @"&% @b `/   #  / # * @h #%@qb(    %` %@`@g`9!@V;b0@R㿠`/8@G`7"@57& - @@37aa$ ;a& ; ` `a .`"@bP  %  "`@ `@ "\  "` # `&``(`'@'@&   $8; %`@``%&@t@ސd   "`o " j` @gf@%& X  $ @Y; & S '@&G+@bl B   %@B @= `@g9`&*  " 8+; # @ %``&&@#@bt    %  % @g 9"T@h;b|@d㿠` /7 `@;'`;    "4`3W"l`3 x"`3"`3` 29  "`Ŵ  " 8;Q Q@b!@"  #   $@8;  .-5` -5@  ) (2`@ސb`29  "@   #` 8;QT@2i9  $n  % 8j;Q>+@b`2T9  &`Y  &8U;Q)@b2?9  ! D  " 8@;Q@`2)9  # .  $`8*;P%@s29  %`  %8;P1@_#$9 #D@Xc4@S;@NcX 㿠` %7$`+7a%     / 7$/@%`;@ ch 㿠` ;7aa `84;a! .a   9"  #` 3@~cp   - -,@@~#@~ݒ;@~ؐc 㿠- @.hb `!n`#s`+"mu%ob"no%1  #@ hZ `!@"H b%7 #@@ W@"= W%)0 #@ b@  !  @-% 7@"<D% ⁀@ ")0 !@" 9%0 -@ 10 #@70+@" *%-0-@;0b#@"% D5|@~J#c@cb㿠` \7'  W;$Q    `` &` ` C;&=; 8; 0 *   &``-#  &;#    - .&``,4  ` 51#/@cԔ@}; @}ߐc㿠  `9@}Ր  㿠  @}Ɛ` ` 1"///Ҁ@}` ``` @}`9#` `4$  -`+4@b@}`,  1`` T@}`;`@}}`d  ` @P77'`9"ܠ          !@}Q!< > +  + * ,`2`*`.7`41 @}:P/@}4\!t@bS@}+h %a|@}#`@}   `@ ' ᔤ&$@}  "*`1  y:  :}  ./ @+ +-2 L3`       `-@`-@``O -@@`8@aa@|'!خa@aܔ@|Ѐ @| @| +`8a)@a”@|!    3@|bI 9 @|"㿠;@||b    /`/ .`@@|m   ,` , + @  %@|^b@|Z㿠;@|Vb    /`/ .`@  "!#@|?b%@|: %@|6"%@|2b%@|. +` Ԗ *2`@|# +`  *2`@| +`  *2`@|    +` c*+`  @{dx㿠 7h9@{#\1/ `)-`@@@{#(%3@{ݐc0 3@@{3!@{Ґ#L3#@{͐cX3%@{Ȑh 3'@{Ðx3)@{#3c@{ +`  *2`@{㿠;@{c    /`/ .`@@{   ,` , + @  %@{c@{㿠;@{c    /`/ .`@  "!#@{nc%@{i %@{e#%@{ac%@{]c؂@{W   +` c*+`  @{H +`  *2`@{= +`  *2`@{2   +` `*+`  @{# +` , *2`@{ +` )  *`<2`:`@{ +` P *2`@z0DxT4T4TTPTT㿠 -h/@z`\`)&`  / @@ ` ```"!`"!@zp3@z3@z 3@z`3@z3@z!83  " 3 '%@z<~3@za@z3@zPv3  ` (. ƀ+@zaTg3-@z`b3/@z|p]31@zw!|X35@zrS37@zmN39@zh!I3;@zcaD3   "  @zS!43@zOa03@zKa,3@zG(3   "#"!#@z1!3@z-a3@z'3@z#"#@z b 3b$@zb(@zb<@z㿠7aa'`@c7a! ]a  #  U  $ @Q7  $@J  %`F7<  &`=  &97^  @0  ! ,7  "@ #  #` 7   $`@  $@7Z  %@  P &`@775L<@y㿠7aa'`@r7a'`la}  ! d  " `7   #` W  $ S7  $@J  %`F7  &`=  &97  @0  ! ,7   "@ #  #` 7  $`@  $@7  %@  P &`@775P<@y%㿠77'`@8F7'`@ @yTh\`!   "  @y"` !@xbh !@xbx!@x!@x"  #   $@7  %   &`775☲<@xԁ㿠7aa'`@%7a#  aݒ   $`  $7  %   &`775✲<@x7aa#`  7! Ac<@x㿠 7!!'`@17! +!+  "@ #  #` 7   $`  $7q  %   &`775⤲<@xS㿠7aa'`@a&a``!  `" 7``#  `$` +  ( (`.`@x b``%  `"z--,@@x  ``#` h `&d7`` `[ ` W7h``" N `#` J7``"`A `$=7``%`4 `&`/ * (2`@wb``' ! `#  7``$ @@ `$@@-@w``%`@  \`&`@775<@w㿠7aa'`@r7a'`la\  ! d  " `7@  #` W  $ S7   $@J  %`F7l  &`=  &97>  @0  ! ,7<  "@ #  #` 75  $`  $7   %   &`775<@w㿠7'`@~7#` xߐ``$p `% l7``%@c `&_7`` `V ` R7``"`I `#  D# -`,2`@vѐb``$ @6 `&`1 * (2`@vc ``' @# `"@@ !@v# ``#@  P`$@@-@v4``%`@  `&`@7}75H<@v㿠!7!!'`@X7!# R!V  $@J  %`F7:  &`=  &97   @0  ! ,7f  "@ #  #` 7I  $`  $7   %   &`775L<@v.㿠)7!!'`@I7!$C!  %@;  &77  @0  ! ,7  "@ #  #` 7  $`  $7  %   &`7Y75P<@uځ㿠'7'`@7$  %   &`775T<@u㿠'7'`@J7$D}  &`<  %87   '`/  +7  "`"  " 7l  #   $7  %`   %@cX@ui75l<@uc㿠77'`@# 87'  % 87% '`   ,` , + @ @@u2#p @p $k-   *  *`(@@u%`Y #  T#   .`--`@uc$ @B  @=```,`,+  @tc"`+ %&9  * *)  @@t֐#&` # !  .` . #ԩ-`@@t75<@t㿠7aa'`@D7a" >an#  6 $ @827$@+ %&9  * *)  @@t#&` # !  .` . #-`@@to75<@ti $,㿠977@tU!!&`! $`'h\ )  .-`2`@t>   `@  ! h`\  ,+3`  "  ;@t`(@t4@t@  %`y  &t `M   + **`@ @!h`T@s \%ϢM@'x@s  %P  &`L  ) (`6` /`H@ @sԐ` @sΒ  $ @0  $@+ +'`b4 #/ @@![xʁ=-<`@s,,PPPPPPPPPPPP,,PPPPPPP,,㿠97!!&@O7a$J.3"Ba!&-@ ƀ     `- @sV̶  / (@/`2`@sK &`   &`@s@a `   .  .  @s. `@ 3a@s!㿠! "  /`&` /  -`@@X2a@s ` 77753@b$@, `'  ! "@r    .  . @rؐ  '@`㿠`+bD@rā/7%2 7! `-.0.`a Da `@"`A    * () @@ \@r #@rbh   / -`  `#` @ + `@ )#ȱ.`%p@rq+bt@rm`)`% `&``8q`&`S `)*`.(`U"    (.`(`?x@r:   , ",`+` @ @r,    /`-/ `<b @rn5""" S@ @2"2 "(#@@r $hc!S@@00 ? @/`@-#@U@@S@@5 5 ?$",`6#@@q   , ,+ )   /` .`-@"@qցb@qҁ   +` + *`    - ̫-- @q7@q `   ; b *`* @@q   ,`, @ @q %  . .`-@q9#@q㿠`' @q~/7%;;7a' 6.0```)    ++`*  c$@q\    ..`-`@?74@qLBҐ9#@@qEBː;cD@q>;cH@q:㿀`P@q/7#` %7$`; '  /` / .`@'@qE@q; /h@q ;cp@q㿠.7` F GH` T"`7`!#x@p)c+@p#7c$@7 ì  @pܰ &) 6@pӐ" 7#`  % @pð .53@pc7c@p!7!!'`7!$7 !+@pc-@p`` `x ` s @p@p4``"`g7`#` a1 D#`\x & @pt ,6-@plL``%`8I7` `C  @p] &(6@pT`d``" 817`" +  @pE &`+ 6`` 7`@p8%7$`+7a% 5 % @p% .`57@p㿠`7@p^;51h/-`ܺ \] )! .``@o@8:9]:69.@o`]*` *#  ` $@Tْ@!@o㿠;7a5@o7 @@8`(@o+  *`2  74@oh\`%#@Tah!!@@oy1/#-@Tᴔx5'`@ojĦ  @oc  `E㿠;a `9@oQ!  㿠 /` .6` @o@"  @TX  ,+3``,   /` / -@    +  ** @ @ @  ` ` `- `. b0- @@o  b(@T!㿐 3?c/` .6@3`  + .2 @n /` 1u! @ W 1"D@nؒ 5/  ) @.`2` @nɐl@S ! @n" "@Sځ@C    - ,+@ #@T> ``  *   -(`.`(2@nb   *` +.  @ -@ +b@n@n,㿠97!5@nr/7 8c@neh \  Ԓhl @nVc   @Sl) ' %@Sl0@nD#h`\ L)" !Բ$`2.`@333 ̀V @2 #H@n-333̀U@7 @@    Ґ %  %`@n cX-h!h \ #c`@S -h\`/d@SG$㿈.`7`  ! Đ!D  @S  .``,4,`@mՖ`      .` "E`/he "t` /h  ̸' (`/h' (뀧`/h`-    )  (/ @@ḿ#     ,,` + #\\ >#`#d`d@m` @m{    ((`.@@?  @ml!     , ,`+` @ @m]a,`'    /  (`.@mL07#  ;   + * 7#* @ @#\\ .#p#tpt@m1aL  ;    .-- @#\\2#h#lhl@map   +  * * @ @#\\6#`#d`d@ma    . -- @@l    +` + *` @l؁`?;# 5   * *` )  #\\$#`#d`d@lҐ    - -,@@lŐb    -` - ,`@@l"$\ 5 4@QȔIt$AH+7aa% %7"5" <` -  8:@lh`\aT   7 @Q| b`@l} #   %  (` @Qb h-5 @Q` `*(5 #\   `8@lZ  $ .2``~#`!Ըap#p##$a4 Ժ!#x9/!#$ a8x!#tᜨ#la#h!#d#+7#|####aa @M)7!" H/`(4/`@;` 9,(t6 #5`p a##@Q # @k x`@ l #@k# 'T#) ,@P##$@k7!!&@!7!"@ '`#*`4` E #    s h, "%h    "h4 "h    & "'h#h   z "h@ "0~h ? " v $ b%qh $m' "`(ih    ? "s]hZ "kWh   T "Mhh "tGh" L c#1 <#  @k.c\   (` -2@k%#4hK#<#<   * 㰪-`@k2h2 0#<# @j h2 #'!  # @L'#  $(`6 hh`\  ""#@L#h\`2 "#"@K#`#@/`5 #` +75"@fЁ0DX $<Tl㿘+7a%&`@@f) '& +&@KҒT@f`Lh\`mh`\    ,  ,` #& **  ( -`@@ @f`\    (` /`;& +`+   *  ,`@@ft`ph`\ &  *` (2@ffh\( X`\ ` "`   @2` /&@fK ;&@fE` &` @f@` ߦ  D    , +*   7 `3+@cX)*& .@@{1&@ -v1&@ q1&@Zl1&@Ғg1&@b1&@\]1&     **`(@ A  =@p6#cX!*&  5-@*-1&@ &'1&@ !1&@1&@O1&@1&@Œ 1& @ 1& @e7!"  #!$c̗) "!$("!$ @6"!$`! ` ! `! ! `1  ` ` ` `(`+ ( @ ! 㿠` ;9a(a(#`- " *`2 @2  @2   2 $ &   @4  ݕ-  $D ldT L< TTTLTTTL㸐`r7!'@ i! &'  H 9& ( .`-@@J!&@d +Q. ``%` E`% @**`@ ,  (- . - , -@  @  7&@dĐ&@d``"` `$3&*/ - @d`&@d``$``$ &`,`(+@ @d``$ `%`  ,`,/`* (+` -` +1& * @  @da``' `#` ,` (+`) , -`+*@  ,`@5& @d4``" `$ / + -  @'&@d (&@da(``&@i`# d-&* - -`@@'@c&0@d#!<@c     + 5&*+`@@c@     (!&-,`@@@cА!L` ``` `*/&* + @ @cX     -(!&,`@@@c!d$ ;&@cat``$ `#` * *`--` ) +`+  * ,`@5& @c||``" `$ ,*. @&@cb!(%&@c]``&@`   *  - / @'@c?&@cl!&a@c; ` ` ` ` `*%&+ +` @c(     *+&.(@@ca      *%&+ - @ @c *+&.(@@ba؀-&&@b@b``#`C`$`> & *  .`. @bא&@bԐb`` (`#  ##&) -`* @bb&@b``#` `' )&  +` /`+ @ @b"``$` `$ / -  ) @, @,` ..` +` / @ 7&@br ``" `"(,`+@` #@ `!@$ @bl-@@@$``" `"` +- * -  -`,.@+@  / @@ 7&@b0``# j`$ e   .* . @X&@a@`@EN3&@abD``# @ F` #`?/ . (@)&@a֐"H (&@aѐbX``"%`#   5&%&((, @'@a`@aߒ!l@a ```` `) &. * @ @ @ap      +`5&,-@@@a|` ``` `) 1&(* @ @  @a{"     ,+`5&-@@@al$;&@agb``% `% *-@  ,-  * ,`. (+`@@ 9& @a8"``"` `# * - (az1&@a"`@Dܒp;&b@a%&@a``# d`% _(( , )  -+`-  *-`@#& @`b``"`@ 7`"2+`,/  @!%#&@`Ȑbܐ`@D+&@`b !&@`"` ?`& @ ` @ ` ` `. ` ` *`/  ` `,` `-& ` ( `-` `, ` .  @@`"``"` `#`   (-`, @ή&@`q`@D0;&c@`g``" `' .*`-@ /  .   - ,) @ .@ @7&@@`:``"` `$    * *(@|9&@`#`@Cޒr&@`c& @`c``$ d`$ _   *) -@R&@_(`@CH;&c,@_``# ?`#` :- - .+`@( , .  / -@@ 7&@_0``"`@`     + **` ! &@_c@`@Cb-&@_D '&@_H` `# @`&   /` . *  *`  -  ,.  ( @ ,`/& T@ @_g``"`"  -`- ,  !3&@_Lcd`@C /&h@_B&@_?l``&`! &t,`+`/` @@_')&@_$#|``$x`%s*`*(af&@_ `@BȒ\;&c@^``#` S`$ N,. -@<5&9&# $``! 6`"` 1   .  - -  @*   * - -` ( +@   @^@^ 7&@^;&@^c㺘`&H@C77;&@^c ` ;":&e  ";' & ;'. - - @ @#  @$d@^t /@$&@^G  " ;' &` ;',` , -`@- *  ) / ,` + &#ش@ @@^+&@^c  % i;' %d;'**)  @V7&@] @AL&#@]  $ @D;' $?;')'''((.@'@]Ґ @^! @]В  %9'7" 7#` %d#'!'..  -@@BҒ`@];'`@@]  @]㿐@]}#'`H@]  M ;'9'`T1' ` @] )' @]u@@ؒ@]p d`;'@]j`h1'@]d l`'@]^p '@]X t '@]R`x '@]L| @+'@]F`@]DV9'-''' ``F @]7 =@]&@@@] 1'@] `'@] '@]  '@]`'@] '@\`@/'@\@\@]㾘`@-7' 7 ;' #' - *( bh`Ƞ@A@\ǐ`  "'  #` 89' % 89'  ,  /`,@<;'5'`к $   & @ "`   -  + .  )  @ + -    ( (` .  @@@\v@`@\q@  +'@\i`  ,  ) (@;'@\Z` d 7'@\T7"` 7#`  )7+'  *  /') (@@\9@\7a!!$@7"` ''%'#7((`.@'@\ @\C!@\aa# i7" d'`--`, @Aa@ 7'''aH@[$  `,8G9' ! ,A '''  + +`*  @[א0(`/`. @@` @[Ȑ8`'``,` ,`+` @ @[a@``  `. -`.`@@[ `9'@[!P㿠` '"hh @@'@[X `Q'n7", d7#`,@ _'`a'```/ `-`,@ !'@[lap '  /` + *` @[_ax-` --@@@[P!``  `* `*`(@@[A ``@[97aa#  %7$`@''```/ `.-@@ᜲ@[ ;'a@[(tL|t| t  㾠`57"@` ʴ '  - / +  @ @Za@=%@O;'a!'@@%a@Zِ!5 cp.@@ !   +` + - @  @ `@7'@Z@>t''@ZĬ`;'@Za  `s n   . !'/ + @   @Z!'@Za! X#@S' `a ` `, `(,@@@Zs'@Zpa"`=%  85'  (` +/ @  @ZX+'@ZUa%@"$`'  . - *` @Z=9'@Z:!#` & -'/'  *  *`(@@@Z!@Z `$@ )'`"``.`+/ @ @Z%%`Ϯ  * * )  0  "#!  ` `@  `*`(* @/  `/@%'@Y̐@=.'@YŐ  `5'@Y;'@Yb"#`   ( (. @" 9'"$`$ j" @ e   `` ,` .`+`@  @Y  T5'(@Y{ `H C   +`+ * @6'4@Y`@=,/'@YW83'@YSb<?% @&@` `' ` `+ `,`+  @ @Y9bD'@Y6bH! % +'  . ((`bP@@Y'@YbT" " ' X   (`--@@@Y'@Yb\# @ ' d  . ,* @X'h@X#`$ 1' *` , (@@X̐"l%"    -`- ,` `@/'@Xp@5(,@N#$@5%`0*`-. @#(@N0@1ǒ7(4@M#` $  ((-`@!1(@M#8@1(@Mڐ#< ;( @ @MԐc@"`7(# !( #H  . .- @@M `@ ++`*  !!(@M#L@1`/(@MP +(@McT% @7(&( c\ /` **  @Mz#` $ #(.. c`-@@Mb @t" o,`, + @@ @ !b'(@MGd@1X7(@M>h 3(@M:cl?%K7( E (  -  ,, @@ @M t(@Mcx" 07(%@*``9(``+ `;(** @ @@Mc@M#& 87(# !(.. #-`@@L7(@L㿠`/ (b@@1#(@LӐc "(@L̺ 7aa#  %7$`@'(```/ `.-@@㼲@L;(c@L c  #(  "-    㾘 ( p /- & ,,`  @1(@L~cȀ,;b""    ? # "!) $`()7"# 7)%%"3)-) -&1"'$`())")=9"*;b,"7))7!!$!%*. (@Ԓ!!(!(@L#(@Lc# ' @Ӹ` `/(-) `5) `* `* )  @@'@K@L!@K@K %`#`  %)#)   +` +  ( (`  *-@@ @KŐ@KÐ` $  "`)!)/`/ ** -` ) @@@@K (@K 07#` f%7"`a')8((/ @@K)@K`@7& J7!& E)-`- . ) `H(`*`@K]7)@KZP7" ##` %)+`+ * @ ( (`-@K6X)@K3``$`$ +)))) (/`@@@K`h@K l$@")3)--,@@J`t@J`x#  '  3)7;)--`,@@J``+ *. 8@@/@JӐ;7aa'  a ),,((`*`+@ @ @J )@J& v! q)-`- ,`@ @J )@J"[%V)* . `(@@Jy@Jw`7aa#  @#7a$ ;%)/`/ - @J^1)@J[ 7!! @$!`")3)--,@@JA@J?```#`  `'  1),`, +`@  @J' )@J$ `` @`& ')   + +` ( (`  **`@J%77)@I$`Ƕ% 9)**- ,) @,` @@Iڐ )@Iא`%@%)+`+ *  @@I)@Ia'`$ #)a/`/ -`@@I@I 7!! @k!&  f- -`*`@) (`,5)@@I~)@I{!$" E" @ )   * 0 .  , ( -@-@@@IX )@IUa8#  "  ) !D - -` ) (  /`@.@@@I2)@I/aL㾘`;)cpah3)@.C@IaX 7  c;b$"))p@I @I|7aa" h7a#  8d9) )   )  ( -@ -` /`,@ሴ@H1 #+))@H7aa#  ;#7a&879) ')%)  ( (`. @@'@H᠐@H!@H@H7aa" 7a#  )   . -,@@H9)!@H㿠`W!7!!$@M !%H!3h`\`  7)  *` ((-2`2@Hm)  @-b  * ))  - , +( @@HM! !h #  ;) $  ?.?   3) @@H*b ' @" )@H ' @ ) "`@Hb   ׬' @ ) #`@H"  ? .? ` +) @Gb  ' " )@Gb, '  5) ! @GӐ0   ׶'   ) '`@GÐ4 !h  \%`1)@G"8%@v;)' p 5)  + +`*@ @ @G@ `a+)@GbD$V;)%P  9) * /`* @ @@G|"L&@ A!)@Gt"P# 6;)$0-)* ) (`@G\X&` !)@GTb\7!!"@ #7a$ @%)```/ `.-h@G;;)bl@G7㿠;7a%77 @)bt@G$ 9)& "|@G   .  -*@2 ` `- )4"@G7@G7b(h\C A)b<   *   (6,,`$@*(`3 5  `  +`5@Fڒ @ & D%)"%) 9*8" *9* "*9*"*9*    * "*9*€ "%*9* ")*9*Ā"-*9*))@F"  `)@Fb `5)@F{  )@Ftb    ')   ')  ')@FbЦ %) 1) *` * (@@FS  -`+)@-2`@FJ" ) . *2`@FAb  *` ) (@@F5b7(@Fgh`\g)@F*!Ѐ17!Ԁ)@F `*3)%`@)NP c@F%)@F 0G @F 4 ) %) -` +.  1)@E< ` ` `*` `* ())@EL ` ` -`@-2`@E#X ` ) ` . + 2`@Eېd ` ` `*` `* (@@Eϐ#p @Eː #) %) -` +.  1)@Ec #)  * *`) ))@E  -`@-2`@E# . + 2`@Ec * *`) @@E#ˀ ')1*@E ) 7*  H* + *`5)@Ey )  (` - )*-@ @Ej#  ,`@ * 2`@Eb ) (`2`@EZ 5    .(0`+   . - + @ +  ( 0` ( +` +@*@ -  3 @E' Ю\   (@.5R    + - + @   @E  @ @E `< *@D`l7 @D`x3 *@D. @D* *@D % @D`! @D #*@Dݐ` @Dِ '*@DԐ @DА  +*@Dːa  @Dǐ   ή !(@D㿠  `#*@DaD+Ҧ%a `@% `? `n   /* >@DL㿠  `7*@DT'  m`㿠97 "("('"(`2` O^ I  O`& " I*` & V  %`& +``/*\ ` @DX * `ad@DP ` @p  7*l@DB `  /` ̄@ 9* a,!t` +a,@` *  <`+`& a,@D) ` `@@5*@D;* `a@D@D@D %㿠`` ;*   / .`5@Ca㿠 /`?``     .-=``7*@Cᘁ9*@C!㿠 9!,@   * $@CԐ !*@Cϐ! `  `". # *. a̕* @ @Ca- 7 *̐- @@@C! 1*!9*! . ̀@ *! *a}`* -`@` + aح=@- &$@ $*@ @Ct㿠 ` ``#*`"%*+*`")*+*!*@C\!@CXa@CT '*@CO@CK!@CGa 77S /*@C=Ԁ;* 9*@C3"b@C0㿘  *@C(b  `'``&`e57``" ҐnD  Ҙ 2; !  ` #~*@BaЀ $'7Ԁ @& [~+a / cЀ;7aԀ @& 㿠& `.' ̀0L7@Bb(?507T@B(?  &`  >.8`.`6 6   ( '    @ ` ( ( () !̀0ah+7@B}b(?907!p@Bv(? ' `  6  à`707@Bb(?507@B[(?  ' &'`& # à`;07(@BCa?%0@B9?  $  ! -@&$ 3 à 0a@B?&`   !̀077@B(?0@B ȁ?  !̀70@Bb(?!0*`l@K @A!܁?*)% "8-`1 !̀30a;7@Ab(?5?*`l@%0H@AԐ?`` E"  "  + $" % &. . 2?  # *` $ @*`&&.& .&?)0.*@@A"  "`( 7  " 1 & .  .` `.` '`.`&p  ."? 5  ** @"` &&X&?+0.*@A;bM     D& .?&.;&.7.??&* 0@A*"   & .&?0.*@@@"(&. &??.*'0@@@0C0A    怢"-%0060ꀢR "00   ";0ڀ"/0" "7008 $  @@%`)"tb ?-`) '#a  " @@ @@Y     $ @@~$ @@z57 @@g( r p5-`Ը!  #` $ #\!    ^@`3g$=`]@@> ! 4   `  $ `  @@#`$. @@. @) %@  `@  $  ``2\@?$`2@?`,   $`-`0`b@@?0`D@?ہ` `#0bH@?ҁ%P`'P8@c`4Ե67XP` 8;0bL ,-N#h#lhl@?`P90`8"P#p ` 10 p$%F#h#lh@?}l "Tؐؖ o@?v @?ܲ &`NK$ 0" 0  @ #!   0.&'7@?{(`$   ua W    ` `'``` "97"(`'"( e"(@`&`(@"``&` ^`&`* NԤԺ 2 `@?2` $`"\@?' 0bd@?!  0$ ԰b" @?&/` '0dx,`@@?` -0bL`,@@>97∲"(@>57b(@>@>@@>㿈 r7 ( 0"@>ؒ00Ѐ@b0&@>ǐW@>ÒN E&A1+0Ő'@    @>Ғ*    ` `90"@>b@>z0b@>rp   0 7@>^"(wh \&0c@>N@  `30c;7@>Ab(Z  ` `````  '- @ 10+0cH10@= @>#0&%`0cP@> %  *  00#\@=Ւ 0@=cX%"F `;0cd77@=( ` ```` ``%0x@="'`'0@=' +0c@='-0@= '50/7@=('㿀77((&(   ' *ǒ #0c@= &@`'  ' +y )0#@=i~&d 0c@=Tm` `.` " 11` @=1@=8` @%l< 1@=,E`   1`0@=&1H@=& ' )  ' - B 31`P@=&@ @<_@<y@<۔xxxxdxxxx㿈Z 97;1`h@<ϒ"(@&@1@<Đ`th\1` 7@<"(א17 @<(쀦`  `%1@< )1@< /TH` -`@  3h3h`\ 7157@<~(㿈쀐V7` (1@ \ `4@  `\x&@t @  x\&@"x x T  x M` `2@7<   `2@7L  '`@\ # @\7 !         .\%2X <&@@7(`\- *`+`**`,3#3`#+ ` /` Ϩ#7b(R#dd $  S$.d  `$  F $+ d  $  R$(d`  $  P`$,`d` $ ې W$-d @9`$ Ӱ E`$*` 9$ ͔ .9҈$*!`d` x `#      @6Ք4  @6@6/`@' @6@6.@'OV @&7`/ 33 ?"@ +` (`" ) % & ('@(` @6 d %@$%%@%  @6u % 52@=` %%% % %%%% %   (x72@6xt :.h\ *|(&@  @!\ #@ x\* 6 `\``) (2_2@6I&@2@6Dᤄ&@#h3h`\ hd " dh52@@60d`2a@6)2a@6%d 2!@6/2+X#pcL#l$ \$ ɪ  <$+#t$  $t)   $l &@g ``   # @ Z &  U   %% %l z.@2@5ɐ؀   % 6 1  2 (`@-`2`@5!2@5a2@5!2@5a耥 m  " !     2@5r2@5am-2@5& +2@5bb32'2b$@5y5A  @>  #@@   ```+  "@ #@ Ƀ**` ) @ ```) (`+  ! !@5;` ł2@54,2@5/"0   %@ #` 2  +  *( @8@5 32@5b<   % | # w  2 +  .`)  @@@4"Hժ'2@4L   %@ \ " W  2  , .`* @@4ԐbX   #@ A `<2   *` ,*@ @4\2@4b`   %"   2  +` *`+ @@  @4d{2h@4 ^  %   2  + +`.` @  @4y"pZ2@4tbt >  %@ ! ܬ  2  *  +,@ @ @4Y|:22b@4Q 0 @  " # ` @4:@ 퀦@12'7"(@42t %  >`%.`%2 p@4 , #t7b(#b( ϒb( >`"`,h`\d  8 !h \z@hS``PJ` GA&?9 7 0 /  0 +h5 5 5逦+`逡 h '`D  " "<2b@3hrh h@hG-h#7aԀ9h \`@Kh2!7⼤"(@3t` `$ I > $* x!2` x!,@3k@3n S d@3i Fd@3d Rd@3_ P!d@3Z W)d@3U E<9Ғ@3P .79Ғ@3K < <@3GtE@3B >@3> >7h@39 >㿠77' `&2@3!b72@37  (` &` - ` +`&`*```&` ( ` &`+` $  @ `$`&`  ]` &` ]. @2 +@2 ܀ @2㿠;"`;3bL9"@2  㿠`  7!!" {;3!# v;3 `t&`` q!  % h  '`@d;3 ` `"`'@!3'@@2"P VT#`& ( `=&9`*F?  `8=;3 ' @88;3``%`(+%!, 3@2lX  +3a"`@ @2`2'@`% 2```%&TĀ *?  @8;3 " @耦``'   - b #3D#3@2bh *а?  % 8;3 %@``' ` -`⸮` 3 3@1"lx3u *?  " 8;3 #`@ ``'   -)"`+3+3@1ːbpN *?  `8x;3 &`@r``='   - 3ΐ3@1"t)3& *Y?  $@8P;3 #@J``' ` .`b ` 33@1|x3|  /  "& # @ !``' @1d쀧 "`3`@1Zb'@"'@%+!3@1N"'@;3@1Hb?㿠;7aI  D/Ժ   ?f8`!h`\ 3@1"3&⤒ 3@1" 3 b*" @1 ?  3@1b5@ Ɛ `  -h\`33b@093"@0㿠93#(97@0ޒ!!&! % 3cD ,+ ) 2@3c8@0ÒO`t %` D3@R}3'3%7<(@0   @ `% y "%.@0n &@ % f%* @@0T&`2L3  #` C  $`>%3 @ -,6`@0b  &@/  *t3, @+ 2@qcT3@0IL @  7"( !"( !+7 "b,`%b,,2 3cd@013-7c(@0,@0, "@0( #7b(@0" "〧`㿠7 a34;7`Tb(@0   a`4cȗ.  @0``4``h@/ '4!7x"(@/`+4@/` -457(@/`4@/ސ``` 794"( @/ԁN`;4@/͐`J` ``` `` :`  ` @734`(@/`` ` * ` (`-`@``8,4,``ș, @ 7@/"(`  '4`%!7"(@/ǐ -@$@'4@/`  %@@/ 4-7`ܲ(@/y7457/7@/s((% @/㿠 @/1 ` @/+㿠mi7h\ /4  @/K34a@/D㿈74@/:؁ ;Ғa ɐ |% `/ ’h\ <; 18)4 ,a 4= @/ !4 L : @/;%5  =` ; 1?#` ;` @. :"`1 8@#44b@.אa8 `7 ;  `@.Ɛ ? #3  : `1+4 Tp8@.b ` L`7&@ :` ,&}c6@ /` # 4@.aЀ '7Ԁ@ /@`Ѐ;7aԀ`@ `` 㿠 ;<`` #`1 4`+`+ 2`" @.C    * *` (  .- @- @!?$Ԙb(`4`0-,4$`@./@@ 57`/4 @.D@7`74 ?L@. 㿘   ./  - ( 6`@ ,  + .* 5@ 4`' `%%44`1 +T @`? @ Է4`9 4 @ @\ Ԧ "%",``? ?4,@ #\#`b`@-h`\ 74|) ((`@@- 2` *  `%!4"@- ;? +`%4@-+ )4 "4`@-|C0=>㿀 @54@-m   ,  +`( /  0``ʥ4`<+ ` `"4;4`"4;4/4@-D⤑/`"*`)h-4@-9 \`74*. + @@@-)ⰰ 54@-" c   ,.-@`@ #x: :   ++`x* #|  4-` |5-*   ڹ V + @ +`4 * " ,`# -`-\#p#t bp@,tX`@,ѐԗ/`"/  14"@,ǒh`\ F4-`-* @,@8`%47h@,\ ". #4(`+(   @,b`b@, h \" 4 , ,`- @,`c @,~`94#@,x` y9474#$+c/h(-?b \b   8d14    *` *(`@ @,T;hh    ++`*  #|& &   (`+|* @ #xƉ"x#ƕ R,-R#\#` ` ` `( `(` + @   (  (` +`  #p)  (#t+`  pt@,;hh@,#㿐7 / /@+  ` @+ S`'  @U㿠   Q N 94#@@+G -22 @ -+2 4cL@+ -;4!2 c\-2 @+$`|㿠;7aa8   %@,` & '` ` ` `, /` * (2 0'4p@+m `  34c@+a ` `-@* 3 * 946`#@+O7bb&`%77eX% X- i`a`@o ` ` ` `. `**`@  nI`A& 2`+/X$` 7!Ԁ`Z  $ #`  $` h  + * * @  \   %,  $( #`& &Ȁ &  '@ '`Ȁ 'c #h`\ 54;7@*b(M =`*h\`&2%)7` 4@*x#)7  "@ 8)7 #@ `o4@*a)7!4@*\#)7!Ԁ`5񀦠51 逧@/逦〧b ހ ܀`E׀EՀ`DЀD΀`C̀CʀbŀÀbaaL@L!4@4 ```{{`XXbf}{`vt`omm`h7b7`h8^8\X a  `X@ a@)`!)!׀@`@a=;fm6m4g20fn.n,g*(g`Icbmnn+4c$@)`V`Z`w`{```@`@(`@`u`q`s`5`````  ``$``R` 9` 994$#@)]??74h@)U㿠;҈a N ` p  E @ J  D "I !5@)9` ! `"@ !5@)0 ! 5 @ 5@)%`$<Զa a8 ! `!! 2h\ "\,'(К""7Є  !ܮ`"!5a&  @ "`  7@<@@ )?&%A! 71& 8`@ #@ $@Hq" ,,`7@] " ,@B@ ;77b8`@ '@7978 @''!̀x%7@9u @|7a@-/u/ 㴀! !(7"@_#&,, 17!@ uO`7@2 u!"`,`",9!@ 7" ,@57@ 77!ؒ/7 @87@ub8",@a(  7a(!(@ (@A;7'aH'@@@5@;"$*@@"`, @ 4 3h/",@7L@`X!h%r1rrX rcT Q #N I ",@耐 ",@ 7@{!P "`,@I #9" ,@;7@kaTa s"'ܸa ,''% s(! -",@?%'@7&  `1! !7@E!Xs%7x@?sظc 67h\ "8 7 7ؐ@Ғ! "77ؐ@ʒa" ,@ @ 7(a@ @Ȑ-/7 (@@+"\`,@t!7 "(`&` 1 ``&`,`@z ",@5777ؐb8@\  "@&  " ,@w2    X7"@K,@i@&@ Ӑ@ "`,@㿐;7b8;"`,`,@$ @ 7@I"p77ؐ@@b7@;" 7b@  ' $  `' ,`)7"@% +7b@Ԓ  '   `' .`97"@&@ @ 㿠@Ð"   O` & N`.``/`'` 333   ̀R @00 @ (" `0* *@  Ԟ㿠9" 8' 8' 8 @+a5 @H"# 7@b @{@F 7@  @w @n"`#" @H(& @  @#7@c '@H  @HK`&'`` "㿠9" 8?/%? 8' 8@G @H, & % ?` 㿠9")7 8#' 8' 8@`%! ĀaЀ /Ѐ `@& 7`7` @@7(  ( ( ` "`* `#'`  ā@Ґ 7 c  J㿠;797a;7#$b8717@0@57@4!/7@8-7@x+7@c)7@# @c㿠 ?;7b(;ua ^ M - 3? ' /  `' (` ' +  ' * W  @ ' " ` ' + '  `' .р  @X M@T -@O ^@K瀦`㿠A:> 79ub(! ^ M -&` ? `'` 2 ` '`/ `'` .` '`) `W  @`'` % ``'`+``'` !``'`-Ѐ*ϲ&` `" @ M@ -@ ^@䀦`㿘;a m"E";`3 b!07$h! _@@@)""": ?`$@* +`#  ) *`'@\@<8` &.`&18- @-$[ @\ @ 9 '@(&<`;(# $@58 $ @<`<8@0   ! 5К@ "`, `#888@x`@@u & &! 0"a "_@ @@ @: ?` .(`$.`. '@%@'@K'8@OH 7$h )87$h  `gl@D T"""_@@@= ?`%-8*`%@ - @,`'@Z@_@@@  8`&.`:&:. !'@@"d㿠8`@;7ڸbL!8 #8@ `  !`> `.  > @`.) `]&`  㿠 㿠 ``    ` ;"78ऐ`D @9" D㿠 ;"`Ā  /8  @,    a @   ,`8`!@q㿠  .`;"98 aĔ @T;"aڜbdh @ #   @"! 㿠'H'L'P77'T98'X;7a;7b8@ 8H@N  @TM 37b8@v @ 㿠'H'L'P77'T98'X;7a;7b8@v 8H@N  @0M 37b8@R 㿠  `   `@`` `@ݐ%8   M  ,M``,`, ,@F  7@8`wx@; 7a@8 i@ %7@!8! `Y@ )7!@'8$K@-80B@ `  N#6 N`  . N`  .㿠N ` N @  N ` ` u @ W8!L@[8aP@V`     @   (@   `     @   (@   㿠;b8`/8X38a@ Z98@!Բ@ 㿠;b8`7 `7!  8 !,+3`#"@@ 3!98"@1"@  )8" +8 -8'8 @"4@bl@@@ 58@Ȑ@ l㿠)7!!&`879!%!b8  3b8%`&@79   +   +` )  *` *(`27`  2  - ,+(2 ID6$a5  a#9/9 @p`@n&@ l79&f79  -` . (  , @ *. @-` 3 )  5 30a9`@A``9  9!@ z9 @ u9`(@ paa`   @ @ faa` a `a +b\@ P 5@l@@ E79@xxxxx(<Pd㿠;7aa%@N7 I9`@@ bx' #쀦 7. 9@ 9@ : `@ :`@ :l@ !:!@ #:b@ %:T@ ':@ ):"@ :c@ ށ5:4@㿠;:@ ͒c<;:c\@ Ł㿠78`2 7#`17! $89;   )  (`; ,`  *@ +`-;-` (@2`:5 ;;,`0cd3 , 1`4#7aa# d17! $@8_9;  *` - ); ( @ -@ + ;.@ (`6`;5`+;) 7``<0 Ȳ`д * +  @ M '@ I); @-;@ސb @ - *@ #9; @ׁ㿠-7' 8m7;&g b8 ;` ; ` ;!4` ;Ԁ`  -* @  -&@ * @A``$`17;`$+`   (@.5`    +  *`2 @  & ,@, 3@  .`-`5 @ 7;@a㿠+7aa' 8o7<a&ia7 8  ;b`;`; `  ; < `  -* @ p -&@ * @``$`17<`$+`   (@.5`    +  *`2 @ E & ,@, 3@  .`-`5 @7<L@㿠!7!!'`!  #   `( 2 '~ h\`A@ɐ~/A9"tԔb|)h@ \A5A#H#\ !@  ` -A  +  ) @ k2`@  $`@ʢ  @83A  ' /Ըb &@  `~. @   ŀZ* A@k#`@  )A#  `  #   #   *`(`2@H    "n # @ i ` `(`+ 3`A@.$`@ pA0@$ A@#<`&@ *@=<A  # @ ;` #@6 ` `* -5` (A  `'` ! " ` `,@+ 2 ~`2@\  %P 3AAch@Ձ3Acl@ρ㿠7&  `@@""<(h@\+ 6'AAt@@|%h\`)A@#    +A "2B{+B4 9 "n'Br+Bc@9A#@ːo1A#Đ@Z &@@ /A@ù@[1B3B@j` V1B`(@P1BBh@I1B  " K "@ FB @  "B%B"#B%BB@8`$1B@31B!B@. 1B@*a1BD@%1B\@e 1Ba)B@!@[1B-7@!(@D;Ba@㿘+7aa#  a` %}               b<g*`< / @.(h*  `(\)  6@- @.<*  7 *=2`32B@B@|c!,@BB B!BBBBBB" B5B BBbBBB4@b@ `B@bDB@{bPB@v\B@qh B@l"thB@gh \5B#\#`#d@X ddހ  B/B@Kc$   @C;BBBcxX#Bcl@0c @o / *`0`@c  +` ) 2@  B@P"C`!u$``"`C`$9BCB # \@4q d% @+``%  r`#  m `C@ `@  C`C5C@ @` C@`@ C@ C@ 4 `C@@ C@`L@ $ `&@4@0`@Y C `@”C@y`t7"(@3Bb@qC`x@k㿠;7a#7a&)%"<'h\+C`@W-C@` 1C! @$ \7C57@?(@r|\`\\\\\\\\\$\\\\\@㿠. -77`@ 8   ` "89D```,@ , 3 @ @ # $bz򚼯H@v@w@8@NA#7aa#` =7 #` 6   ؃)  *`+` @ #` "#\`\¹$%X^\TD P NN܍L hF#\\h h ?7!!#`8J?! D ! *2 :``4< `&9 `0#`  `@ . "`) @ :'? A `P A `P  #`A*` A*ن * J*? @    7 " @8-  @' ` `# ? `* *`0   @     @8   "@ 8   㿠?.\  7?aa" ) a ` 8%? a  ` :?  `     ` " `?㿠  '      D "DD D " DD D!xaaDᤁ!a㿠j9D!@S `3 /D-D7D5D!Dئ! ? @@?   + @7? (`@,@'@"?   * ,D D`@!􀦠#D@ a &@$`' i)D@"&@`;D' _b@㿠 @ | |;D b-@ٔ`@󒦀㿠; aa;D@@b @  &&9   1&` `  &`    `7"D   #+`&`     ` "bD/` &`@ &`l h\ h h h h h h h h h h h h  h h h h h h h h h hP@ h< h h h h h h h h h h h@$ h h hp h h hN``nk 'D)uD0!aH?N# A`:K-`ŀD 5 M D  *`(2 )bA@  }"`   @#-@  * @NN` @ !N 2 `"  +7aa a! `   + *-@  D D   *`*+ @bH @  37aa" \ a `W`    .`+`- @  ` `  -` (+@     +* +`@   `   - *-` `D"T@ s  D b` @ k 37aa#a ` `   ) @ (5` /D /D .` *5p @ H v7!! `!%`瀧`   *  -+ @  -D -D   (*) @@@ | L7&` " `   ((`5  D D +  ) 2@ b *7aa" @a% D  @ +7aa!  a"Db  @ ה |/D@ ͒&|  `   D @ & |&D@ |`߶@ D@ N ϰN ` @ 2D@  "   @ %N @ N@2@ ̐  %-<<|& ې D"|@ W5D1D@ Qd@ O#h  ȐD @ CN ` @ mN ` 2d   * + ( @@    !$x " 'x%'x x'x x " 'x$'x  x'x xB'x x` @ x"@ o-D@ PN ` N`@27(  ( (` "`N* N`  N #D@ ÐcTN@  N` eN``[ `#p`%")``*" F!7$`|"@!7a`;a %ޔ"%"R @O@  3`/A` @ z @ P ]"``5@ .@1  "(`$"( ""(`'`N``,@ N`1! &5D@ HN`@ C`㿠;# /b,7h@b,h @  ` `  2/ ")  `  @    + #I&@ ` ,@ @  +I`0 @ ט/I8 @ Ϙ    J J    *#  㿠@ I&` `"  8"` <"` @"` h'L' h5  ; `aܬ' \'' `" @ "97!䀣 7?a@ @ !􀦠  `& ? d L   ;خؒ@ 8   8& < & 8@67'''' @ 'АL `& d$& h & ?& d$& h& h㿠 `` `@ V ` @  ~@ !  ;7a @@ 2! @ !?'` N /@ " d  I+Ԕ Xb d@ ј@ 4@  d. @ M '`%7䀠7@I``@ !4@ 6 '`6'77@3I`h4@ ! `4'`@@`@ `" `4%`@I`p`@ߖ`@`@y`@3-7@5Ix@ U!$ `@z!I `@r `@ 'I`@ +7)Ib8 @  `@ /IԔ`@ J 71I"8 @ `@?`@9`    %  { '`  '` '`  '` '`  '`'` '`!` @_ %7@#Ia @ђ!)'`#@ n✀  77@+Ia0@!0@ 0@ ` ,@ (@ $@@: ,@`! (@`  (@`  $@`:I@ #D7Ib8T@&`@ -7@I!@k!7+a^@.b#@ <+ @> $ `*b\@8< &,&@-&-`,$ ` `@@  17!@f/I᠐@3!a 5@3@b ` `@@  7@K7Iᰐ@!F`@  7!@9 I!Đ@!3@'`\``\@ '````` 7a@#@9!`15'`x-)'`%!'`p#'`tܦ#X'`|؞#,'`'`'`I`@Ғ!` `@^@ 㿘@L?`027IL?9-$ &@ N0N9$`@ N 0N`9$@ M"&`9I!!@ 7IВ!@ 㽘;Ia@  % v@"6 17!@'I@l!?` 5I  @]@&?   㿐'' '@   ;7?a@i5I!@5㿐;'' ''@ɔ !7!@OI<!@?`$`(/"")`` ` @/'IT!@?`@@)I"t!@?`@3Ib!@? /Iⴐ!@ٚ?<HT $0`lxܝ㿠9  Z. @@)ԁ"+ԁb-ԁ/ԁ ԁcD3ԁcl5ԁ7ԁ9ԁ#;Ձ`Ձ` ՁLՁp Ձ Ձ Ձ`ՁՁ,Ձ!XՁaհᐁ!Ձ!#Ձa%Ձ'Ձ,)Ձ"X+Ձb|-Ձ5C3Ib@/C(4@LXdp|㿠9 "W. @@+Ձb-Ձ/ՁՁb3Ձc5Ձ 7Ձ9Ձ#(;Ձc4ՁcDՁXՁl Ձ#|Ձ#ՁcՁ꣬ՁՁ#Ձcհ!Ձ##ց` %ց 'ց4)ց D+ց`T-ցd5C3Ib@~/C⽝㿘 ';'`t{ 㿈 @ٔ  '9'  |7 hI  c w㿘 ';'`S      a㿘;'`? I  c LN㿐'?9'#''@6㿘& 9C &`#  &@ ֶ`'%uN 2@ & M .'@ &`N  `.'@ &p#t  #x  '@ڔ   37a@P5It@!? @ɔ7@@7It@ !@?70'#|'@7@( It#(@!@|@?* $,"@,@2'17!@ It8@ْ!@j|@h?'7'@0x@l)7!@/ItD@!@M|@K@? #h'0#`(`|@ߔu@A7a䀧 ax-7@It#X!@?!@`(@d}@7䀡 ~2'7#@+Icpt!@al?# `$x@@<x{@67a䀢 ~ !7!@m%Itx!@8C? `$@l(@s@ʐ6(7䀢~ #\97!@E;Ict!@? #\t#p#`#d#h#l@+ax?ax@ N@D@|@ft&? @'x&  p@ p@㿠    p@`@.a` `&@`  `! `! `! ` ! " 㿘';`Ж 4  `! `! `! ` !   㿘!''&`   -<@.  ? p7<  "  㿠!`@F &``  -7@o+IcĐ @<!? `&` !@/.&`` 97!@X7IА @%!?`!!@ /`!㿠!`$ x  !   !@! ! x??&   @ @O 9I#ܐ @!;J `!@ܖ? a `  @ ` " `   `  㿠;a耧` 9!`ڒ `  - 1&!.?!耣` ! @    `("*@  !耣` !@   `  ) "*     , 0   7K  b8 @  |@㿠  @Д ? ;7a@D9K  @!? 2  @㿠  @ ? 77@%5K @!?`` @ ?  ;7?a@ 9K ( @ڒ!@ t@ @㿠;K `4@!?㿠@!  9@Ô!'`5 T'` '`'`㿠 @!`!@@i @݁ہb㿠@ @d㿠9K p@y;c@@@ !uO`! ` @  5u`@ O` ` "`O`3ua @ 㿠` @G`@2   /7\!K t@)!?%@T@ %@T  @I@ %@I%% %% ``` `x6 `%`&`'`&  㿘p`h  ?2?` @ 57K`@!?&&&7aK @!@?&`\&'7%K@!@Ӑ?&d&  +7a)K @m!@?& l&17!/Kఐ@V!@?& ` `` `'` &` 㿘㿠8  $   @o  @h ` @a ` @Z@X @R ` @K@Ḭ㿘? ` 9C7C`#-@$ !-5K @!㿀%K@ː  @p  97!1K ܐ@!? '0@Ȕ @  @J+7a䀥 ~ -K!@ ;7a/K!@@?0a&`@' 7!K!@u@?@& % ` ?&`#0 @%?&`-8)0 @1K?& `!4@H!?`&` &&` 㿠'H'L'P'T'X;D`H` 9D7DHH!@ L@ 㿠9C #ĺ?. @!?`#? $KP,@&`'Kɐ` @&@)K!p&@&@㿠;C 'c;C c @5&㿠@  @㿠 " " `㿠 " 㿠 " Ka㿐'T; 'D/D+D'H3)D'L'P'a&b%D%`H@g L" T@2R?'C##5DC"` DKᤐ @!?'L`L')֦ '@2%)D@o@3+bȀ /DD;Cc3D&`DP 5쀦D@ DDD` DD`  D`D 'DK'DD@$ H$H$ @1N'㿠?u㿠 & ` @o&  ,` <" <` T" T` #DD D` ,`<``T`#`㿠;C c'ѐ ,`" & ,9D Ɛ `' D㿠``  ,`  & ,`, &`, `, " &`, `&``㿠 , `" & , `` ,  & , `&`` , `" " ,㿠А` " Ő " " 㿠Ő` "  %" " 㿠 T"  '`㿠`  @?  + +`*  Ò%&``%` @   -@$f&``$``  U㿠\ " V T%% J" `"   0lCc#d  ?  i""  #c""##dA #      ' p !   {    2   ؀ l t 3y  hp  z# q l  i kQ mU u  q rπ ww     z { t    b X                                                     ` [       "                                 4 Ka㿠   " '`  "   㿠  )MC"73C 7 n; `󀦀"kC!C #%C?㰔"` 'C 5C%Ѣ Ԕ& c/CԔ%+<` 㰒 1  Cc ?#    7@ C %\C!7c rC % `  #! ` @~  %  @v 6'C mL1C/C -Cl%W `Z# P㿠 C##h8  e.k (5 : b   V % H J 2`umk h2i9рle`qOr3 z ukw{fKɁ .`ρ@#l?c Ē  5  @b @Ɛr EC11  c9  󀦀_ܒ   &J 9? "`y 9 o < h (㰒 - )C'C%CY Cc7# `@Q .# I  㰒 C "a7=  5   ` @)    `@       ɒ  B" 1" +"ܴ #"ٴ %"մ !) "д '- "˴ ) B" 1" +" #" % ! " '% " )  !  -  /  m  `  25  p   {g 5 \ `5& ` 'Q _ Ԫ Z 7 P լ K (  @  ;`& "    #& ##  #  #mb @`㿘 // /6 /6 /6`/// C# #, ` $܂  &О?  ɞ<  ž     `     㿠 %"8" B<,  ޚA њ ɚI s@㿠` `$` 1C`3C*` $# bc ^ ޒ Ւ ђ @v㿠` `!`  `  '` ! ) &  ؒ Ԓ ǒ@>㿠` `!`  `  '` !    ؒ Ԓ @㿠` `` `뀦`ݐ_ 0 " S E " "   AL 0 " @ E "  " h  ,F4 0 " ( E " " ( 0 "  E " " E  r # 0"  E " "  0"  E" " %  R 0"  E " " ؒ 0 " Ր E " "   ,Òΐ 0 "  E "  "   Ȓ 0"  E" "  0"  E " " ʶ   0"  E " " }  q  @㿠` `!`  `  '` !    9ؒ Ԓ I@lllllllllllllllllll 㿠7`t~.`@  *-  &-   ޔ ٔK4uOĐ &  'Ē   ϒ"'`   `Ӕ@!-h@$<0HXdp|㿠/.@ C h _C#(#` Ё#C c5c Ɓ)C(##-KX/Kx7K;KbKbKK K#8KcXKc9C#KKK#L`L<!L \#L`|%L'L)L} +Lza1Lw! 3LtaD@k㿠Lbah " ?m;L&i;L? C# #< Β4`,i2${cl ? ƒ p z)L!`` ```` {`Uaԁdp|(,,<P0<P d|,, |Н㿠7& Ѐ &/ @@   @B   @=   @8   @3   @.   @) g  @$ p  @((ށ 5ځ L!  Ӂ `ρˁǁ Á` 3  @ 2  @    @   @߁  @۔    @ԔĒ @̔ @Ɣ@  @    @ @ @ @  @   @   @ z  @   @{ k  @q   @k [@c U @] O  @U   @P @  @F   @A 1   @6 B  @㿠  (;Cc7`"  E" " $㿠 ;Cc9C"  H&#%  " " 㿠;Cc`  Ҹ̒    . (˒ƒ    @)㿠z(` ` %`!   `@㿠` ``` >?`"3L8?@i?3-LԒ@g?(/L0ɒbL@7L T@9L "\@;L bd@ pp @!```" L  | "a&` 5Cɐ(/C 0't t'  ܐ &% / / 3L`bА  '`-`#` `# `/``" & ;/ "`"  &`` &-/`/`%` `-`#  % 3""`!  .`l ` ` P&C`㜗.`#  %``" | -l! -`s & `` ` k .`-@#e P%C#-`@`" [ &- ` R $% `' ` I -`.`@#B `&-# ; %.`' "` 3 %``` ``$`@` `` %  ` t`@%`+`l&`  t" " @PpdX, 8D㿠9Lmbȴ `.`@@(#Cc  3Cckh )?#  "7C㘒  -C Ӕ   ;Cc  ”LbLL@ L#hL cL cLMTM @M`XMp!M #M`%M'M)M +Ma-M/Mߐ(1Mܐ!@3MِaX@㿘```4`` Ifp}@ 'Mt ?? 1?..`".` C㔀i 0 yM9zG{"T pM@#Mau’@@9M!e@@MaU@ڐ@qMaEA@ʐ@aM5;@ﺐ#l?c ƒ @G;Mbhy@M "0<` ? @j*  6 @CM``#CM#Cc?`" ``  ږY  ```Mǐb@)/Mｒ`3Mbﴒ``M㮝` '` Mb`M ` '``M  #Mc4 'O@)M#Hl@9M`9M#`_@d'ف/MtGU'7M8@-㿘@ `` /@'@ ` * ' M㤒  !M # ?,'3Mc7N㿠'H   H@ː@``` `L z` `a`"cHpe`jj   H   N(( ? H`H!?#?H,'H*`H"H HH  *@-'HH  H  H   H5N?HnDHB;Nd``HH@O㿠```C;N`>C㔀`` ` ` ` i`& {-l`7? ２ ﲮ`fw z9N` |;N`؁ `  `" 㿠a a " 㿠Z ` " 㿠@,`@H" "  Na 7 7& 耦.@@N( @`M  @Cc" `ΐ`"8&``&`2 -C" } x sߐ @m)C#$ `g``&`&`Ð " `P㿠W[    <ퟐ ǐ/,`(`& `@@` `" ``u``m㿠@d o l '  '` & & 㿠 @O] " Y &'` ' ' 㿠 I "  B  "  㿠Րِ1 ``@0@- @ & &``㿠C cT, ` < - $'9N슐!D .&* CcT " 㿠 ߐ " "  0㿠 㿠 >  &' < = + |%   5" ڰ ܔ %" 짐 D죐 T'` 옐 " ð@#۰㿠  Ws;N)C#`L5#G#;cq W` q  #q  icq zq  {l`#?c | r!#q% 6%N̐x%;N5 p@(7C3C㼸 c -C>n `g.륐a㿠 0"   E" " 㿠  ;N;Cc c`c  ہ  Ձ  ρ `iW 0ܐ 0 " А E " "  ː " 뿐 E " "  쮒Ȓ붐" 뫐 E " " 젒뫐" 렐 E " " ɦ 쏒쩒뗐" 댐 E " " 쵮~ `z p {+)#l'-? 즒 윪 _a p@ہF(9C#  5쌔 " K;Na㿠;Cc` `q`u"  9Cސ    ֐ |   _  [ 0  T#7Nꯐ0 㿠;Cc`u7C3Nꢐb`@   9N"Ꚓ @ ^㿠;Cc`u7C3Nꉐb@  9N"ꁒ @ E㿠;Cc`u ( 9C5N#l㿠;Cc`u ,9C7N#^4 㿠;Cc`u  9C5N#LX㿠;Cc`u  9C5N#;㿠``` ;N`` /C㔀9C#;N`@;Nc㿠` `!`  `  '` ! ΁ ˁ  \ؒ Ԓ l@㿠;c`c`%C&&&` # ##3Nǐc5 c    \㿠 6  3 4  5-Cf3 7=-`5h`7N閐Cc@ C?렁#hO酐`C3 C㨴?돁c?- C㤴 녁#Cc?& 'C㠴?yh 5C1O] < 7C?㤶h@NC@JC@FC@B'C@>7C@:Pp0XX㿠5&  ǻ/ @@#h O `` 3  i  4  c vhO  3  Q  4  K ^h`7Oऐ 3  9  4  3 F%h`'OؐȐ 3  !  4   .-h`/O 3     4   5h`O訐a  3    4    Ch#O莐a0 5  '֖  $l``'`` '`` '``'`+ch 7OpT 5  /  %l@`@Xp㿠5& ) )/ @@ 6    6    6    6    6 M   6 Z  {@(㿠9Och!t F   v- GQp`2  ꀦ F`)O! 4  N  4  H x 3  ? T/h1O! ) *_ +[~ ,Wz -Sv .O .`7Of )c *:] +6Y -2U ..{  @㿠9D #'`<D'`d`'` `<`T`<`T$ $ `<$``T$`'`$/- @'`d%㿠;5Da;Dc/ @ &Ɓ㿠5D`^ ?' ` ` /   h &@& $A,9 !`@ 6  h 5 ? `,  h2   <  <`h h` ` & T``h h  ` "`` d Ƥ$    3 ` @ 3 `( " ` !D` 8` `   @"``` D#P`  `@ "  㿠;Dc? c^` ?  ]%`- ""  8+@   P+`@   $`/`9!   0 H d  0`$`㿠7D  ^/`@  $A,3 a` 6  l 6 ?@ , l3 @ "  <   < l l ``` '`` T l l`   " d Ƥ$X㿠 ? ?7-<ƀ  #?  `@ ``?     2     `" @lxl ?  "T `)     `  `   ? 㿠   , #!@ !` @ @"."@.@"-@ `5@@& t& x& |@㿠 $;a. @  &  d %  "`<T`||@x"|+ "|d`@ 㿠;D '`;7`t31D-D&h#TaȲ  -@䠒 @䞁*`&uș*  ۀQ@3 3  (#@ D(`#!)  D      D `` `   aȉ+` # a  h# h    "  ` ?" "`㿠9 !Ȼ.`!ȯ. P``0 "3@"0'@ 2@"'@,p P"@`"/@!"?@" _@?`!O䯐"@; &  & 1E& @      < T" T" <㿠  h ;E `?+   [ `  a   $`'    `& ' $` 8`9    , ( " ` @  @& & $ &$`~` `>a *7@`&``) ?`E `` &`' " #` ?' %E ``  @ &`$ `@` ?' E ` @ &`"  T@`@`   E ?%E&` &`' $4`E``T&`<`?`<&`T``) :` 6`` `0 ` ` )`@#`  `?`@ ``?``<`T-E %`<&`T`T&`<@c㿠  DJ &      ހ     !ۀ  0 (  b $\ ,  <  0R 4 @R d# T L  D HD瀧 P> `  T \O ah  t  d l |   : "X) J `@  Ё`D*'  +E  ` & Ȃ` & `@ e %`  ]`@  `@U   `@M   `DE  `D = `@aȗ+  `)&  `@!ȵ,  &  % '`@ `@ '`@ 4  ````p`@` `P  &  '`@?& `@ȃ(`   `@I   '`@    `@'`@ 3 `D!ȕ*@ +5`@ȡ,`  `@`D '`@`& `D'Eaȯ.``& $  `@'`@6`@aȉ* /!`@!ț+ '``@` `0`P `` `p`?&  &  & `@ v Á & `@`D `@`Dh'`@`D`@ - @.3a & E !Ȇ& ``@`@`D *@ .@   & +#EaȠ  & $``D~ `@.`@x / @`Dr㿠! ` &`@&`D/`&@^ * @;E '`?&&X  @ H `Ր`` ;E͒` ? ` -@ 2`&' `㿠 p ` @j H` @3 H`    ` `"  `   Ȁ    ` ` Ȁ  `   3E& &`Q  &  &  & 4  & L`     ( ` "   (  `    @   ```       <  T   T   㿠  <JE ` `T<   <$   <&  b?쀢 /    @ "@B" `, @ + =`    | $ & <?` ׸  pȀ  Ȁz`p`<  `p`<`p T e  `<`<@_ `h0`` ?@ ) S  Ȁ   `T`T`  TAT``<<;``0` h ) /`Ȁ@  ` T T` T"` ! T`p `< "<"T "  E#` pȀ  Ȁz`p`<  `p`<`p T e  `T`T@_ `h0`` ?@ ) S  Ȁ   `<`<`  <A<``TT;``0` h ) /`Ȁ@  ` < <` <"` ! <`p `< "<"T "  E#`㿠;a $@I`/`  Ӓ d `$`-`      0rp H d  0`@@`     : d ``p" "`p㿠9D#` 7#Ě  ` @ % p` $-;a` 0<TِHd0%&㿠  ` '  `  T<@  <&       `T <@ `` % `   & 㿠;E `&אo>`㿠 @  @~@㿠;D cc  & `  < T D#`## `  `   ` `? ``` ``  `   `Ҁ  `? `?`  ` `@ <`<  T`T `  㿠; a;Dc     `$d @ ` : &`- `-` ) @ 2"- d` d@  `d` ۢ``ͤ$     <`"` <d < `d" < Td"` T ``d" T @ ` 㿠;`t@ܽ;a@ܺ9"@ܷ7@ܴ5@ܱ3a@ܮ   2   㿠3Dc`9D#`<'``T` 㿠;7DaĤ & $& - %@ < T 㿠)D#`9D#`<'``T``` ` 㿠9D5##`'#@ݑ* &Ā`Oܞb%&&*&@ȑ,`$O܉"$@۽, #`+O~b,1ҕ2&4`&Y^@(- @ۢ&!!Od"4Ҁa&   `@& h- &耥   ` ! l(`&䀥   `$`8`0`H) $`P$`0(%@$`H@+ "@ $`@$`X   `  `/ '%&@C- $,`@=, #taȀ 1 t7O7O<㿠/D -D T&    <3ց  ` DD  | -`#@# |'@ 9  `8& ( @ #O۷bD `   &    `W &`?`M`7`` '```2B`` ="<```` Ԓۃ `"  `  ``Ԓq/``@  Ԓ(e/` ` 2`Ԓ<V`$ ``@Ր 7` '` <"<  < ( ( @%     &  /` &7`'`  /` T ( ($@#a  `  &   /` .7@@#@& /`  㿠D9Oc"T ` '`,&`@.* ,`,`@C,`'|'|`'`@k㿠 `/``& @ &   573/O\ @!? `@ 㿠@ھ`  &` 㿠@ڨ 2 㿠7O?h?@ڞ/O l@ڗ `&` && @2  ?&  &` & 㿠@}?2 㿠;cxcx`@١  ?ua u" 0 `" W" 7"`  H`H`.) H@H+` "0H.) ` +`"`` "`H  ߈ 㿘;Obp@u 9?)O"x /` &`#`&` 㿠@3 O 5uO :" O  O @ * O  /`O ``㿠;` `/O-O@&`&  ` @@m@ @b  @ @Ȕ  㿠;Oٙb ua u" 0 `" W" 7㿠9u! `'`   '   @ـ㿠  `' & ?@e 㿠;E ` @؝ ua n Ԑf `& c`$` - & X` $` -: & O` $` א": .y (#`!'u y,  `& * `$` '``,  p @ސ@ڐ@֐@ѐڴ`   ($ ? $ $` `` (`   㿈;(l c'7 7  ''''@  2? ? c  ;`  *@ 2 ;  `*@ 2  ?    +` (` @ 8`;`   @ "  ` *( @  @3 2    @ " @(* @   3`  2  `  (  *`"  @1 0  "   㿠;O b@F!?㿠 7b @I 4 4@ׄ㿈@+! 5O @n! @;!N `- 7ON 7O17" @ 7a9/O$!@x  @ٖ  7&O,@!e(l#Ԁ&(l4 " (`1?7 #)?-4@@ (l@#Ԁ  (l4 O#8@̒!? & (l4  &$ &$쀣`OP@ִ!'&&&& &\ "  "  \`- &\\@֕ &44 9O#d@֔!@֘@ؐ 4   &`&,&0쀧`b  &(`2 &( &(&(&(1;@:&7-&x)%b&p&t"(&|"0P&&&㿈 $  @ $  !7!d 1O#p@0!?"ְ 3O $ c!@#? :?'?`@@**`1 0` &` @ `-  @+ 2@4`@ @&`   ( (`=;   &`<` @ ` @*`,<@&` &`&` &`&` (  `` `` &` &``T?` O@տ!?`a܀a` |'`@`@զ'`  %O'`@՟!? `@s`  37aӺ+Oc @Շ!? 1P` @!?&`@c" ` @L`"  77Ӕ5P\ @a!?9P` x @X!?㿐'L   % \ ``  `@6L  `@倦``2   & ?㿐`  '`'`'` '@s` @n㿠 ? +P` !@? N`- N`5P37b(5P@;7a 7P !@ߖ  㿠@! ?"?@Ϟ800H<\DXDht08p ,`?& ``  ```  4*   `8 @ @ @ @(`. +`   8۸ * * 1 ؠ  :ϸ Ѡ Π ˠ    @8    * ) (`    @8 +@ + 2  :   :  @(`      /   - @   +`"   -%@{  . v   ( (j    *  *  ^    * * R    + +F  - -;   .  . 0  ( (%  )  )   ' W  "  w   / 7     '   W   w      ݠ  /٠  7ՠ  Ҡ Ϡ ̠ @ӆ D  `    @  @ 65    `    ``  6   &  `42  È +`+` ?  `?㿠 ` +P)Pa @҂`0   @v``9P!    @a   @ n@ (08@HPX`hpx (08@HPX`hpx $,4<DLT\dlt| (Hd,@Th|   0 @ T h |  L D㿘#\!p a  $pp "$p )7"$\ 77\(' p@V$p@>z@#`bp~@l$p!EL -p +`M`P . @ E"E"`P@+S P%. * @ P@+ RP(`S+`PքPhEE`) V%#dE"!M+ -$p✀~(!!!+!+!!!!!!!!!!!h P`dА!,hPdɐ@!9!:!!!!!!!!<!=!=!?!?!@!A!B!C!D!E!F!>!G!H!I!!!!! ! !EEH-/E`r. ! ! ! ! !!!X!Y !!6!#!$!;!J!K!L!M!R!S!P!Q!N!O!V!W!T!U!%!&!'!(!)!*+h`dM!,!-!. =!4!5%h)ud+%#!3;h`d@0#u$c!"7hdx9u'#!13h`d5u&!0hP`d !Th1P d!tu#㸁!"u c!"u !"/u %㸁!" u !#!"u "!"u ##!"1u &#!"+u %c!"'u $㸁!"#u $c!"9u '#!"5u &!"u "#!"u  c!"u  㸁!"!u $#!"u "c!"u"!"u ##!"1u &#!"+u %c!"'u $㸁!"#u $c!"9h d;u'c!/3h7u`d&㸁!/hPdza8hPdHra0!h\/ d @& 1hE dJ% # -p`$  EpE  p#p" $p` p @ Ch@[  E  +! @4 1h d$pp #`2 :`~3E @ h d$p@p* h`d܄pE` $p@ ph`d. d$p@@@hdp. p+`$p!@!㿠7/h+E?;dad?`` `@?    `$@`2   `&@ # `  L,? $`$`?$ ?a @# 1 ?   *`   3 $  . $  @e`$$ @L 8' ? @#  4)?`3 *   `# ``& `?  ?* ??  (@  ` @  d$`? @O$`  @ `?&` `@ ? % $ `$`? `(?`@.?'`@?㿠;7ha0 d0@90+-Eb:@?>@,$N` . N` `* U%`%`U+`SU.(`U*`RU`0@ +`S  a* R@ EE "R@"*S@Ŗb@$R@%+ )  `+ R@@+`P@ @ R@ @ * #P%" 㿠;h93E`d!a`O (H`2?  ( &$@   `@"@Y2??`@&+`-`&M`/ 㿠;a`975@9&!@h@㿠%` 5E+EN .   %` $$ ;E@ '` h!?`E#`E?!!"d? a!K`+ 㿠@ː (/@&  @ &;@b &@㿠3a@ 7&` `@@㿠@&  `&   @א@ۺ  $ &    " +` +` " " " $a㿠` #M M` @[ (&/@K'` '`'` '`'`'`'`'` '`$` '`J J `   K `` @㿠`@,)@#`  N `@-  ., 9@#4& 㿠;7b8;P@ڒa @P㿠@e㿠@I@̪㿠;E'`㿠;E`` 5E19E'  ua u" 0 `" W" 7㿠N  `0 Nx" NX  N` N׶^N @P"Ȓἂ`#"Ȟ,\<\0 L ` t < h   d  < \  X HTdt$4DTdt$4DTdt$4D\t(@Xp\ ,<Ld,Hd ,<L\l|<t@ #| #x97)'"!!κ?$! #h- >#p=#t<0#d>0>#\p#` p#l*#" &~!4@\xtR$5t#x;`t#xx,#(@ >   V`@6   x*⫴ ,` T @2 2  # *`  `#`#`# ` p -@9-#-"$@ % V# ,`%ְ ̐dPp,`UQF耣&   &   Z  d "8-) R@)R@ Ѐή #`"  耢 ?#a#ucc$$$| "|$`#|Z\ @` Ĉ#p% ( +`  ' ' ' v* @1"̬"   ////h,`̌''' \,`̀''' P,`̑''' D,`̅''' 8,`''' 0,`''' (,` / / / /++++ ' ,`'''  ,` / / / /++++' ,` / / / /++++u ' ۑ,` / / / /++++] ' Ñ,` / / / /++++ۄ ' ,`Pl,`Pg!,` / / / /++++' @,` / / / /++++' @p,`''' e,`''' ],`''' U,`y''' I,`ˊ''' =,` / / / /++++ ' &,`''' ,`///,`/// ,`///,` ///,` ///,`///,`''' ,`' / / / /ܑ,`1"̬"'   ////͑,`C ' ̖   ////,`1"/ "'   ////,`̖   ' ////,`,'  ̬   ////,`$'  ̘   ////{,` ̬   ' ////m,`'j,` 'f,` 'b,` '^,` 'Z,` 'V,` 'R,` 'N,` 'J,` 'F,` 'B,` '>,` ':,` '6,` '2,` '.,` '*,` '&,` '",` ',` ',` ',` ',` ',` ' ,` ',` ',` ',` ',` ',` ',` ',` ',` ',` ',` 'ޑ,` 'ڑ,` '֑,` 'ґ,` !'Α,` ''ʑ,` $'Ƒ,` &'‘,` %',` ',` ',` ',` ',`P',`',`',`',`',`r ',`m ',`b'~,`]?'y,`'u,`݊'o,`ݝ'i,`ݰ'c,`ݻ'],`'W,`'Q,`'M,`! #耣`  a  `-'- +P"d(,`PIbx" 'PA"'P: P4␀1P͐",` ',` ',` 0',` ',` ',` 0',` ',`ڻ',`ٔ 'ߑ,`'ב,`А 'Б,`ɐ 'ɑ,` '‘,`ڻ 0',`ڴ P',`ڭ @',`ڦ `',`ڟ p',`ځ',`',`R',` &',` |',` <',` >',` ='|,`'x,` 't,` 'p,` 'l,` 'h,` 'd,` '`,` '\,` 'X,` 'T,` 'P,` F'L,` G'H,` 3'D,` 4'@,`L ' 8,`D ' 0,`̖   ' ////",` 3' 4 & ' ,`S''' ,`,`". $,`$ # # #lh T+`U 8 *UT 2pUpU| 7b/֘#bɐT|`耠 u#1ː?&! $9$ 3`W '   $` .  #|UQ`8*U U  " u ## $$$b  @$T$ ٭,` p@Ґ,<L 0L,@lP\<|p|\l `X 7 `d- |̔ܔ`` ```,`0`8`<|`D`Hx`P`Tt `\``@ m`d`hi`p`te`|`a``]``Y``U``Q``M``I`Ĕ`E`̔`A`Ԕ`=`ܔ`9``5``1``-`a)aa%a a!aaaa a(a,a4a8a<a@ aDaH aLaPaTaX@ @ `a| a|a\ #E`!@`#\ @3E#`@`㿠㿠@(#) $Header: /tcpdump/master/tcpdump/addrtoname.c,v 1.96.2.6 2004/03/24 04:14:31 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/gmpls.c,v 1.2.2.2 2003/11/16 08:51:05 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/gmt2local.c,v 1.7.2.2 2003/11/16 08:51:06 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/machdep.c,v 1.10.2.3 2003/12/15 03:53:42 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/oui.c,v 1.2.2.1 2004/02/06 14:38:51 hannes Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/parsenfsfh.c,v 1.25.2.2 2003/11/16 08:51:07 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-802_11.c,v 1.22.2.6 2003/12/10 09:52:33 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ap1394.c,v 1.1.2.1 2004/03/17 22:15:53 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ah.c,v 1.19.2.3 2003/11/19 00:35:43 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-arcnet.c,v 1.15.2.2 2003/11/16 08:51:09 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-aodv.c,v 1.8.2.3 2004/03/24 00:30:41 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-arp.c,v 1.61.2.2 2003/11/16 08:51:10 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ascii.c,v 1.10.2.3 2003/12/29 22:42:20 hannes Exp $@(#) $Header: /tcpdump/master/tcpdump/print-atalk.c,v 1.78.2.2 2003/11/16 08:51:11 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-atm.c,v 1.33.2.2 2003/11/16 08:51:11 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-beep.c,v 1.4.2.2 2003/11/16 08:51:12 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-bfd.c,v 1.3.2.2 2003/11/16 08:51:12 guy Exp $0HTl@ @(#) $Header: /tcpdump/master/tcpdump/print-bgp.c,v 1.72.2.4 2004/03/24 00:04:04 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-bootp.c,v 1.75.2.3 2004/03/02 07:45:13 hannes Exp $ (LBL)dpxCMUcSc@(#) $Header: /tcpdump/master/tcpdump/print-cdp.c,v 1.19.2.5 2004/03/24 06:00:51 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-chdlc.c,v 1.28.2.3 2004/03/24 00:46:03 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-cip.c,v 1.21.2.2 2003/11/16 08:51:15 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-cnfp.c,v 1.14.2.2 2003/11/16 08:51:15 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-decnet.c,v 1.36.2.2 2003/11/16 08:51:16 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-domain.c,v 1.86.2.3 2004/03/28 20:54:00 fenner Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-dvmrp.c,v 1.24.2.3 2003/11/19 09:41:28 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-enc.c,v 1.1.2.2 2003/11/16 08:51:19 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-egp.c,v 1.34.2.2 2003/11/16 08:51:18 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-esp.c,v 1.44.2.4 2003/11/19 05:36:40 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ether.c,v 1.82.2.3 2003/12/29 22:42:21 hannes Exp $ (LBL)GH5``` ``8<$>,[4\<DP7` dchdpx@(#) $Header: /tcpdump/master/tcpdump/print-fddi.c,v 1.61.2.2 2003/11/16 08:51:20 guy Exp $ (LBL)@(#)$Header: /tcpdump/master/tcpdump/print-fr.c,v 1.17.2.3 2003/12/15 03:37:45 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-gre.c,v 1.22.2.2 2003/11/16 08:51:24 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-hsrp.c,v 1.7.2.2 2003/11/16 08:51:24 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-icmp.c,v 1.73.2.3 2004/03/24 00:56:34 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-igmp.c,v 1.11.2.3 2003/11/19 09:41:29 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-igrp.c,v 1.18.2.2 2003/11/16 08:51:26 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ip.c,v 1.128.2.6 2004/03/24 09:01:39 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ipcomp.c,v 1.17.2.3 2003/11/19 00:35:45 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-ipfc.c,v 1.4.2.2 2003/11/16 08:51:28 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ipx.c,v 1.34.2.2 2003/11/16 08:51:28 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-isakmp.c,v 1.36.2.11 2004/03/24 01:32:42 guy Exp $ (LBL)Xdhlt$(08DHPX\dhpx  $,8DP`p|@(#) $Header: /tcpdump/master/tcpdump/print-isoclns.c,v 1.106.2.5 2004/03/24 01:45:26 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-krb.c,v 1.21.2.2 2003/11/16 08:51:30 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-l2tp.c,v 1.14.2.3 2003/12/26 23:21:42 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-lane.c,v 1.20.2.2 2003/11/16 08:51:31 guy Exp $ (LBL)())),)<)H)\)p))))))) )@(#) $Header: /tcpdump/master/tcpdump/print-ldp.c,v 1.4.2.2 2003/11/16 08:51:31 guy Exp $*|*********+ + +$+4+@+L+\+h+|++++++,, ,<,T,t@(#) $Header: /tcpdump/master/tcpdump/print-llc.c,v 1.53.2.3 2003/12/29 22:33:18 hannes Exp $@(#) $Header: /tcpdump/master/tcpdump/print-lwres.c,v 1.10.2.3 2004/03/24 01:54:58 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-mobile.c,v 1.12.2.2 2003/11/16 08:51:33 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-mpls.c,v 1.8.2.2 2003/11/16 08:51:34 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-msdp.c,v 1.4.2.2 2003/11/16 08:51:34 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-nfs.c,v 1.99.2.2 2003/11/16 08:51:35 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ntp.c,v 1.37.2.2 2003/11/16 08:51:36 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-null.c,v 1.49.2.2 2003/11/16 08:51:36 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ospf.c,v 1.45.2.4 2004/03/24 02:44:30 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-pflog.c,v 1.7.2.4 2004/03/29 21:56:26 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-pim.c,v 1.37.2.4 2004/03/24 02:52:37 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-ppp.c,v 1.89.2.3 2004/03/24 03:32:43 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-pppoe.c,v 1.24.2.4 2004/03/24 03:04:22 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-pptp.c,v 1.9.2.2 2003/11/16 08:51:39 guy Exp $$Id: print-radius.c,v 1.19.2.4 2004/02/06 14:38:51 hannes Exp $@(#) $Header: /tcpdump/master/tcpdump/print-raw.c,v 1.39.2.2 2003/11/16 08:51:40 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-rip.c,v 1.55.2.2 2003/11/16 08:51:41 guy Exp $ (LBL)uuuuvv@(#) $Header: /tcpdump/master/tcpdump/print-rsvp.c,v 1.24.2.3 2004/03/24 04:01:08 guy Exp $whwpwxwwww w wwwwwxxxx x,x8x@ xH xT x` xp xxxxxxxxxxx"x#y$yy?y4y<yLyXyhy|yyy%yyyyyzzzz$z,z4 z8 zD zL zT z\ zd zl z|zzz z z zzzzzz{ { {4{<{P{d{l{#{#{#{"{"{"{{{|| ||(|<|D|P?|\|h|l|x| |@|||}} }0 }@}P}`}|}}}} }}}~~8~X~@(#) $Header: /tcpdump/master/tcpdump/print-rx.c,v 1.35.2.2 2003/11/16 08:51:43 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-sctp.c,v 1.13.2.2 2003/11/16 08:51:44 guy Exp $ (NETLAB/PEL)@(#) $Header: /tcpdump/master/tcpdump/print-sl.c,v 1.62.2.2 2003/11/16 08:51:44 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-sll.c,v 1.12.2.2 2003/11/16 08:51:44 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-snmp.c,v 1.56.2.3 2004/03/23 06:59:59 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-stp.c,v 1.11.2.2 2003/11/16 08:51:46 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-sunatm.c,v 1.5.2.2 2003/11/16 08:51:47 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-sunrpc.c,v 1.43.2.2 2003/11/16 08:51:47 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-tcp.c,v 1.107.2.3 2003/11/19 00:17:02 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-telnet.c,v 1.21.2.3 2003/12/29 22:42:23 hannes Exp $@(#) $Header: /tcpdump/master/tcpdump/print-tftp.c,v 1.35.2.2 2003/11/16 08:51:50 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-timed.c,v 1.7.2.2 2003/11/16 08:51:51 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-token.c,v 1.22.2.2 2003/11/16 08:51:51 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/print-udp.c,v 1.124.2.5 2003/11/19 00:19:25 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-vjc.c,v 1.11.2.3 2003/11/19 01:09:12 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-vrrp.c,v 1.7.2.2 2003/11/16 08:51:55 guy Exp $ԈԘԠԨ@(#) $Header: /tcpdump/master/tcpdump/print-wb.c,v 1.30.2.3 2004/03/24 04:06:52 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/print-zephyr.c,v 1.6.2.2 2003/11/16 08:51:56 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/setsignal.c,v 1.9.2.2 2003/11/16 08:51:56 guy Exp $ (LBL)@(#) Copyright (c) 1988, 1989, 1990, 1991, 1992, 1993, 1994, 1995, 1996, 1997, 2000 The Regents of the University of California. All rights reserved. @(#) $Header: /tcpdump/master/tcpdump/tcpdump.c,v 1.216.2.10 2004/03/17 19:47:48 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/tcpdump/util.c,v 1.87.2.3 2003/12/29 22:42:23 hannes Exp $ (LBL)3 :Q<@(#) $Header: /tcpdump/master/tcpdump/print-smb.c,v 1.27.2.2 2003/11/16 08:51:45 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/smbutil.c,v 1.26.2.2 2003/11/16 08:51:56 guy Exp $@(#) $Header: /tcpdump/master/tcpdump/missing/inet_aton.c,v 1.4.2.2 2003/11/16 08:52:01 guy Exp $@(#) $Header: /tcpdump/master/libpcap/pcap-dlpi.c,v 1.91.2.3 2003/11/21 10:20:46 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/fad-glifc.c,v 1.2.2.1 2003/11/15 23:26:39 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/pcap.c,v 1.63.2.9 2004/03/25 22:40:52 guy Exp $ (LBL)  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~libpcap version 0.8.3@(#) $Header: /tcpdump/master/libpcap/inet.c,v 1.58.2.1 2003/11/15 23:26:41 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/gencode.c,v 1.193.2.8 2004/03/29 20:53:47 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/optimize.c,v 1.76.2.3 2003/12/22 00:26:36 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/nametoaddr.c,v 1.68.2.3 2003/11/19 18:13:48 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/etherent.c,v 1.21.6.1 2003/11/15 23:26:38 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/savefile.c,v 1.92.2.11 2004/03/11 23:46:14 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/bpf/net/bpf_filter.c,v 1.43.2.1 2003/11/15 23:26:49 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/bpf_dump.c,v 1.13.2.1 2003/11/15 23:26:37 guy Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/scanner.l,v 1.95.2.3 2004/03/28 21:45:33 fenner Exp $ (LBL)@(#) $Header: /tcpdump/master/libpcap/grammar.y,v 1.79.2.3 2004/03/28 21:45:32 fenner Exp $ (LBL)[]dc`^_ajgfehi\  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZbkllmnnnnnopqqqrrrrrrrrrstuuuvvwwxxxxxxyyyyyyyyyzz{{{{{{|||}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~1>?=@ABCDEFGHIJKLNMfgQQQQQQQ/ejQQ5Q44V66QQ>>QQQQQQQQQQQQQQDQQ;QQQQQRQQQQQQ$QQQQQZ[QQQQQrQJevImOij_oXYZ[`j]pzd\^oij}hqrstupbJJyIIOOzGdEmGoOOydGHJzzOO yy !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFG  !"qrstu#$%&'()*+,-./0123456789:;<=>?@ABCDEFG  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFG "#$%&')*+,-./0123456FG{|}~(LIYZ#yJ###\]#5600Zefg#klJcL(0kl##fYZhcF YZc01234df^_`akl0IJcLIJ#IJxyfdWa-./YZYZYZa2d[cc#cklhdkl#kl56xy##YZ#56#defg^_`a`ac\]^_`a#iWW]^_`a  #$%&'()*+,789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWX[_ d #$%&'()*+,01234789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWX[_ d #$%&'()*+,789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWX[_d #-./,56789:;=>?@ABCDEFGHIJ56\]^_`a_efgd \]^_`aij!"lm  #$%&'()*+,789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWX[_dnstwxyz~###00###00tt~YZopwn01234qrst !"{|}h-./56\]^_`aefg#t\]efgqstwqwcccaaqruvYZYZ|###2##copijcpqq#i B( B0 B< BH BP B\@(#) $Header: /tcpdump/master/libpcap/bpf_image.c,v 1.25.2.1 2003/11/15 23:26:38 guy Exp $ (LBL)lookup_emem: calloclookup_bytestring: calloclookup_nsap: malloclookup_nsap: calloclookup_protoid: calloclinkaddr_string: mallocsap %02xisonsap_string: malloc%u%utcpudp%dCiscoMLSCiscoCDPCiscoCGMPCiscoVTPExtremeEDPBroadcast/etc/ethersrnull802.1b-gsap802.1b-isapip-sapproway-nm802.1deia-rs511x.25/llc2prowaysnapIPXnetbeuiiso-clnsglobalUnknownUserUser GroupPrintQueueFileServerJobServerGatewayPrintServerArchiveQueueArchiveServerJobQueueAdministrationNovell TI-RPCDiagnosticsNetBIOSNAS SNA GatewayNACS AsyncGatewayRemoteBridge/RoutingServiceBridgeServerTCP/IP GatewayPoint-to-point X.25 BridgeServer3270 GatewayCHI CorpPC ChalkboardTimeSynchServerARCserve5.0/PalindromeBackupDI3270 GatewayAdvertisingPrintServerNetBlazerModemsBtrieveVAPNetwareSQLXtreeNetworkBtrieveVAP4.11QuickLinkPrintQueueUserMultipoint X.25 RouterSTLB/NLMARCserveARCserve3.0WAN CopyUtilityTES-NetwareVMSWATCOM Debugger/EmeraldTapeBackupServerDDA OBGYNNetwareAccessServerNetware for VMS II/NamedPipeServerNetwareAccessServerPortableNetwareServer/SunLinkNVTPowerchuteAPC UPSLAWserveCompaqIDA StatusMonitorPIPE STAILLAN ProtectBinderyOracleDataBaseServerNetware386/RSPX RemoteConsoleNovellSNA GatewayTestServerHP PrintServerCSA MUXCSA LCACSA CMCSA SMACSA DBACSA NMACSA SSACSA STATUSCSA APPCSNA TEST SSA ProfileCSA TRACENetwareSAAIKARUS VirusScanCommunicationsExecutiveNNS DomainServer/NetwareNamingServicesDomainNetwareNamingServicesProfileNetware386 PrintQueue/NNS PrintQueueLAN SpoolServerIRMALAN GatewayNamedPipeServerNetWareManagementIntel PICKIT CommServer/Intel CAS TalkServerCompaqCompaq SNMP AgentCompaqXTreeServer/XTreeToolsNASI ServicesBroadcastServerGARP GatewayBinfviewIntelLanDeskManagerAXTECShivaNetModem/EShivaLanRover/EShivaLanRover/TShivaUniversalCastelleFAXPressServerCastelleLANPressPrintServerCastelleFAX/Xerox7033 FaxServer/ExcelLanFaxLEGATOLEGATONMS Agent/NetwareManagementAgentNMS IPX Discovery/LANternReadWriteChannelNMS IP Discovery/LANternTrapAlarmChannelLANternMAVERICKNovellSMDRNetwareConnectNASI ServerBroadcast CiscoNMS ServiceConsoleTimeSynchronizationServer Netware 4.xDirectoryServer Netware 4.xNetwareManagementAgentNovell File and Printer Sharing Service for PCNovellSAA GatewayCOM/VERMEDGalacticommWorldgroupServerIntelNetport2/HP JetDirect/HP QuicksilverAttachmateGatewayMicrosoftDiagnostiocsWATCOM SQL ServerMultiTechSystems MultisynchCommServerXylogics RemoteAccessServer/LANModemArcadaBackupExecMSLCD1NETINELOPowerchute UPS MonitoringViruSafeNotifyHP BridgeHP HubNetWare SAA GatewayLotusNotesCertusAntiVirusARCserve4.0LANspool3.5LexmarkPrinterServerLexmarkXLE PrinterServerBanyanENS NetwareClientGuptaSequelBaseServer/NetWareSQLUnivelUnixwareUnivelUnixwareIntelNetportPrintServerQueueipnServerLVERRMANLVLICNET Silicon (DPI)/KyoceraSiteLockVirusUFHELPR???Synoptics281xAdvancedSNMPAgentMicrosoftNT SNA ServerOracleARCserve5.01CanonGP55QMS PrintersDellSCSI ArrayNetBlazerModemsOnTimeSchedulerCD-NetEmulexNQASiteLockChecksSiteLockChecksCitrixOS2 AppServerTektronixMilanAttachmate SNA gatewayIBM8235 ModemServerShivaLanRover/E PLUSShivaLanRover/T PLUSMcAfeeNetShieldNLM to workstation communication (Revelation Software)CompatibleSystemsRoutersCheyenneHierarchicalStorageManagerJCWatermarkImagingAXISNetworkPrinterAdaptecSCSIManagementIBM AntiVirusWindows95 RemoteRegistryServiceMicrosoftIISMicrosoft Win95/98 File and Print Sharing for NetWareMicrosoft Win95/98 File and Print Sharing for NetWareXeroxShivaLanRover/E 115ShivaLanRover/T 115CubixWorldDeskQuarterdeck IWare Connect V2.x NLMQuarterdeck IWare Connect V3.x NLMELAN License Server DemoShivaLanRoverAccessSwitch/EISSC CollectorISSC DAS AgentAIXIntel Netport PROIntel Netport PROSiteLockSiteLockApplicationsLicensingServerPerformanceTechnologyInstantInternetLAI SiteLockMeetingMakerSiteLockServer/SiteLockMeteringSiteLockUserTapewareRabbitGatewayMODEMNetPortPrintersWordPerfectNetworkVersionCisco EIGRPWordPerfectNetworkVersion/QuickNetworkManagementMcAfeeNetShieldCSA-NT_MONOceanIsleReachoutRemoteControlSiteLockMeteringSiteLockMicrosoft SQL ServerIBM TimeAndPlaceTopCallIII FaxServerAnyService/Wildcardnewhnamemem: callocExtra TrafficUnprotectedSharedDedicated 1:1Dedicated 1+1EnhancedReservedReservedPacket-Switch Capable-1Packet-Switch Capable-2Packet-Switch Capable-3Packet-Switch Capable-4Layer-2 Switch CapableTime-Division-MultiplexLambda-Switch CapableFiber-Switch CapablePacketEthernet V2/DIXANSI/ETSI PDHReservedSDH ITU-T G.707/SONET ANSI T1.105ReservedDigital WrapperLambda (photonic)FiberReservedFiberChannelUnknownReservedReservedReservedReservedAsynchronous mapping of E4Asynchronous mapping of DS3/T3Asynchronous mapping of E3Bit synchronous mapping of E3Byte synchronous mapping of E3Asynchronous mapping of DS2/T2Bit synchronous mapping of DS2/T2ReservedAsynchronous mapping of E1Byte synchronous mapping of E1Byte synchronous mapping of 31 * DS0Asynchronous mapping of DS1/T1Bit synchronous mapping of DS1/T1Byte synchronous mapping of DS1/T1VC-11 in VC-12ReservedReservedDS1 SF AsynchronousDS1 ESF AsynchronousDS3 M23 AsynchronousDS3 C-Bit Parity AsynchronousVT/LOVCSTS SPE/HOVCPOS - No Scrambling, 16 bit CRCPOS - No Scrambling, 32 bit CRCPOS - Scrambling, 16 bit CRCPOS - Scrambling, 32 bit CRCATM mappingEthernet PHYSONET/SDHReserved (SONET deprecated)Digital WrapperLambdaANSI/ETSI PDHReservedLink Access Protocol SDH (X.85 and X.86)FDDIDQDB (ETSI ETS 300 216)FiberChannel-3 (Services)HDLCEthernet V2/DIX (only)Ethernet 802.3 (only)G.709 ODUjG.709 OTUk(v)CBR/CBRaCBRbBSOTBSNTIP/PPP (GFP)Ethernet MAC (framed GFP)Ethernet PHY (transparent GFP)ESCONFICONFiber ChannelJuniperCiscoACCCiscoShivaMicrosoftLivingston3ComAscendBay NetworksFoundryVersanetRedbackJuniper NetworksAptisCoSine CommunicationsShastaNomadixUnisphere NetworksIssanni CommunicationsQuintumColubrisColumbia University3GPPAuspexOSFIRIX4IRIX5SUNOS3SUNOS4SUNOS5UltrixVMSAIX32HPUX9%.2XUnknownUnknownOpen SystemShared KeyEAPAssoc RequestAssoc ResponseReAssoc RequestReAssoc ResponseProbe RequestProbe ResponseBeaconATIMDisassociationAuthenticationDeAuthenticationSuccesfulUnspecified failureReservedReservedReservedReservedReservedReservedReservedReservedCannot Support all requested capabilities in the Capability Information fieldReassociation denied due to inability to confirm that association existsAssociation denied due to reason outside the scope of the standardResponding station does not support the specified authentication algorithm Received an Authentication frame with authentication transaction sequence number out of expected sequenceAuthentication rejected because of challenge failureAuthentication rejected due to timeout waiting for next frame in sequenceAssociation denied because AP is unable to handle additional associated stationsAssociation denied due to requesting station not supporting all of the data rates in BSSBasicRateSet parameterReservedUnspecified reasonPrevious authentication no longer validDeauthenticated because sending station is leaving (or has left) IBSS or ESSDisassociated due to inactivityDisassociated because AP is unable to handle all currently associated stationsClass 2 frame receivedfrom nonauthenticated stationClass 3 frame received from nonassociated stationDisassociated because sending station is leaving (or has left) BSSStation requesting (re)association is not authenticated with responding stationData IV:%3x Pad %x KeyID %x () [%s%2.1f* Mbit] %s CH: %u%s () [%s%2.1f* Mbit] AID(%x) :%s: %s () AP : %s () [%s%2.1f* Mbit] () [%s%2.1f* Mbit] CH: %u%s: %s (%s)-%x [Challenge Text] %s (%s)-%x: %s: %s (%s): %s%sAuthentication (Shared-Key)-3 Unhandled Management subtype(%x)Power Save-Poll AID(%x)Request-To-Send TA:%s Clear-To-Send RA:%s Acknowledgment RA:%s CF-End RA:%s CF-End+CF-Ack RA:%s Unknown Ctrl SubtypeCF Ack CF Poll CF Ack/Poll DA:%s SA:%s BSSID:%s DA:%s BSSID:%s SA:%s BSSID:%s SA:%s DA:%s RA:%s TA:%s DA:%s SA:%s BSSID:%s DA:%s SA:%s BSSID:%s TA:%s RA:%s TA:%s RA:%s RA:%s RA:%s BSSID:%s RA:%s BSSID:%s (H) Unknown Ctrl Subtypeunknown IEEE802.11 frame type (%d)More Data More Fragments Pwr Mgmt Retry Strictly Ordered WEP Encrypted %dus (header) unknown IEEE802.11 frame type (%d)[|802.11][|802.11][|802.11][|802.11][|802.11](LLC %s) unknown 802.11 frame type (%d)[|802.11][|802.11][|802.11][|802.11][|802.11]%s > %s, ethertype %s (0x%04x)Unknown, %sUnknown Ethertype (0x%04x), length %u: [|ap1394]AH(spi=0x%08x,sumlen=%d,seq=0x%x[truncated]): [|AH]oldipoldarpiparprarpatalkbanyanipxipv6diag%02x %02x %d: %02x%02x %02x %s %d: %02x %02x %s seqid %04x %d: %02x %02x %s seqid %04x (first of %d fragments) %d: %02x %02x %s seqid %04x (fragment %d) %d: [|arcnet][|phds][|phds extended][|arcnet][|arcnet]et1 [|hello] [|hello] ext HELLO %ld ms ext %u %u [|aodv] [|rreq] rreq %u %s%s%s%s%shops %u id 0x%08lx dst %s seq %lu src %s seq %lu [|aodv] [|rrep] rrep %u %s%sprefix %u hops %u dst %s dseq %lu src %s %lu ms [|aodv] [|rerr] rerr %s [items %u] [%u]: {%s}(%ld)[|rerr] v6 rreq %u rrep %u rerr %u rreq %u rrep %u rerr %u [|aodv] [|aodv] aodv rrep-ack %u rrep-ack %u %u %u%s,%struncated-atmarpatmarp-#%d for proto #%d (%d/%d) hardware #%dtrailer-arp who-has %s () tell %sarp reply %s is-at invarp who-is tell invarp reply at %snak reply for %satmarp-#%d[|atmarp]truncated-arparp-#%d for proto #%d (%d) hardware #%d (%d)trailer-arp who-has %s (%s) tell %sarp reply %s is-at %srarp who-is %s tell %srarp reply %s at %sinvarp who-is %s tell %sinvarp reply %s at %sarp-#%d hardware #%d[|arp] %02x%02x%s%s0x%04x: %-*s %s %02x%s%s%s0x%04x: %-*s %s%s0x%04x: %02x%02x%s0x%04x: %02xrtmprtmpReqechoIPARPKLAP [|sddp %d]%s.%s > %s.%s: [|ddp %d]%s.%s > %s.%s:%d > %d at-lap#%d %d [|ddp %d]%s.%s > %s.%s:aarp who-has %s tell %sreply %s is-at %sprobe %s tell %slen %u op %u htype %u ptype %#x halen %u palen %u at-%s %d atp-req%s %d [len=%d] [EOM] [STS] [EOM,STS] atp-resp%s%d:%d (%d) [XO] [STS] [XO,STS] atp-rel %d [len=%d]%cXO%cEOM%cSTS] atp-0x%x %d (%d) 0x%x%c%d><0-%d><0> truncated-nbp %d truncated-nbp %d [ntup=%d] [enum=%d] [addr=%s.%d] nbp-reply %d: nbp-0x%x %d (%d)[len=%u](%d) %d [addr=%s]/etc/atalk.namesr%d.%d.%d %256s%d.%d %256s%s.%d%d.%d.%d%d.%drtmpnisechozip%d%d(LLC %s) [|atm]%08x%08x %08x%08x Call_proceedingConnectConnect_ackSetupReleaseRelease_completeRestartRestart_ackStatusStatus_enquiryAdd_partyAdd_party_ackAdd_party_rejectDrop_partyDrop_party_ack[|atm]Q.2931 [|atm]:%s msgtype#%d[|atm]CALL_REF:0x%06xSSCOP, proto %d VPI:%u VCI:%u broadcast sig: oamF4(segment): oamF4(end): meta: ilmi: MSG BEEP MSGRPY BEEP RPYERR BEEP ERRANS BEEP ANSNUL BEEP NULSEQ BEEP SEQEND BEEP END BEEP (payload or undecoded)ControlEchoNo DiagnosticControl Detection Time ExpiredEcho Function FailedNeighbor Signaled Session DownForwarding Plane ResetPath DownConcatenated Path DownAdministratively DownI Hear YouDemandPollFinalReservedReservedReservedReservedBFDv%u, %s, Flags: [%s], length: %uunknown (%u)noneBFDv%u, length: %u %s, Flags: [%s], Diagnostic: %s (0x%02x)unknown (%u)noneunknown Detection Timer Multiplier: %u (%u ms Detection time), BFD Length: %u My Discriminator: 0x%08x, Your Discriminator: 0x%08x Desired min Tx Interval: %4u ms Required min Rx Interval: %4u ms Required min Echo Interval: %4u msBFD, %s, length: %uunknown (%u) [|BFD]OpenUpdateNotificationKeepaliveRoute RefreshOriginAS PathNext HopMulti Exit DiscriminatorLocal PreferenceAtomic AggregateAggregatorCommunityOriginator IDCluster ListDPAAdvertisersRCID Path / Cluster IDMulti-Protocol Reach NLRIMulti-Protocol Unreach NLRIExtended CommunityReserved for development{ ( ({ })})Authentication InformationCapabilities AdvertisementMultiprotocol ExtensionsRoute RefreshGraceful RestartRoute Refresh (Cisco)Message Header ErrorOPEN Message ErrorUPDATE Message ErrorHold Timer ExpiredFinite State Machine ErrorCeaseCapability Message ErrorMaximum Number of Prefixes ReachedAdministratively ShutdownPeer UnconfiguredAdministratively ResetConnection RejectedOther Configuration ChangeConnection Collision ResolutionConnection Not SynchronizedBad Message LengthBad Message TypeUnsupported Version NumberBad Peer ASBad BGP IdentifierUnsupported Optional ParameterAuthentication FailureUnacceptable Hold TimeMalformed Attribute ListUnrecognized Well-known AttributeMissing Well-known AttributeAttribute Flags ErrorAttribute Length ErrorInvalid ORIGIN AttributeAS Routing LoopInvalid NEXT_HOP AttributeOptional Attribute ErrorInvalid Network FieldMalformed AS_PATHInvalid Action ValueInvalid Capability LengthMalformed Capability ValueUnsupported Capability CodeIGPEGPIncompleteReservedUnicastMulticastUnicast+Multicastlabeled Unicastlabeled VPN Unicastlabeled VPN Multicastlabeled VPN Unicast+MulticastRoute Target Routing InformationReservedIPv4IPv6NSAPHDLCBBN 1822802E.163E.164F.69X.121Novell IPXAppletalkDecnet IVBanyan VinesE.164 with NSAP subaddressLayer-2 VPNvendor-specificnon-transitivetargettargettargetoriginoriginoriginlink-BWospf-domainospf-domainospf-domainospf-domainospf-route-typeospf-route-typeospf-router-idospf-router-idlayer2-infoRouterNetworkSummaryExternalNSSA ExternalMPLS-VPN ShamReservedFrame RelayATM AAL5 VCC transportATM transparent cell transportEthernet VLANEthernetCisco-HDLCPPPCEMATM VCC cell transportATM VPC cell transportMPLSVPLSIP-interworking%s/%d%s/%d, label:%u %s%u:%u.%u.%u.%u%u.%u.%u.%u:%u%u:%uunknown RD formatorigin AS: %u, route target %sRD: %s, %s/%d, label:%u %sRD: %s, CE-ID: %u, Label-Block Offset: %u, Label Base %u circuit status vector (%u) length: %u: 0x%02x unknown TLV #%u, length: %uinvalid len%sUnknown Origin Typecodeinvalid lenempty%s?%u %s?invalid len%sinvalid len%uinvalid leninvalid len AS #%u, origin %sinvalid len NO_EXPORT NO_ADVERTISE NO_EXPORT_SUBCONFED%u:%u%sinvalid len%sinvalid len%s%s AFI: %s (%u), %sSAFI: %s (%u)Unknown AFIUnknown SAFI no AFI %u decoder nexthop: invalid len%sinvalid lenRD: %s, %sno SAFI %u decoder invalid len%sno SAFI %u decoder no AFI %u decoder %u SNPA %d bytes, no SNPA (illegal prefix length) %s (illegal prefix length) %s (illegal prefix length) %s (illegal prefix length) %s no SAFI %u decoder (illegal length) %sno SAFI %u decoder no AFI %u decoder AFI: %s (%u), %sSAFI: %s (%u)Unknown AFIUnknown SAFI (illegal prefix length) %s (illegal prefix length) %s (illegal prefix length) %s no SAFI %u decoder (illegal length) %sno SAFI %u decoder no AFI %u decoder invalid len %s (0x%04x), Flags [%s]unknown extd community typecodenone: %u:%s: %s:%u: %u:%u: bandwidth: %.3f Mbps%s: area:%s, router-type:%s, metric-type:%s%sunknown (0x%02x): %s Control Flags [0x%02x]:MTU %uunknown encaps no Attribute %u decoder Version %d, my AS %u, Holdtime %us, ID %s Optional parameters, length: %u Option %d, length: %u Option %s (%u), length: %uUnknown %s, length: %uUnknown AFI %s (%u), SAFI %s (%u)UnknownUnknown Restart Flags: [%s], Restart Time %us AFI %s (%u), SAFI %s (%u), Forwarding state preserved: %sUnknownUnknown no decoder for Capability %u no decoder for option %u[|BGP] Withdrawn routes: (illegal prefix length) %s %s (%u), length: %uUnknown Attribute, Flags [%s%s%s%s+%x]: Updated routes: (illegal prefix length) %s[|BGP], %s (%u)Unknown Error, subcode %s (%u)Unknown, subcode %s (%u)Unknown, subcode %s (%u)Unknown subcode %s (%u)Unknown, subcode %s (%u)Unknown, AFI %s (%u), SAFI %s (%u), Max Prefixes: %uUnknownUnknown[|BGP] AFI %s (%u), SAFI %s (%u)UnknownUnknown %s Message (%u), length: %uUnknown no Message %u decoder [|BGP]: BGP, length: %u [|BGP] [|BGP Bogus header length %u < %u] [|BGP %s]Unknown Message Type [|BGP]BroadcastRequestReplyBOOTP/DHCP, %sunknown (0x%02x) from %s, length: %u, htype-#%d, hlen:%d, hops:%d, xid:0x%x, secs:%d, flags: [%s]none (0x%04x) Client IP: %s Your IP: %s Server IP: %s Gateway IP: %s Client Ethernet Address: %s sname " file " Vendor-#0x%x PADiSMLTZiDGiTSiIENiNSiLOGiCSiLPRiIMiRLaHNsBS ENDaDPaDNiSSaRPaEPBIPFBSRTpPFsRSZbTTLlMAsMTsMTUBLSNiBRBMDBMSBRDiRSApSRBUTlATBIEbTTlKIBKGaYDiYSiNTPbVOiWNSiWDD$WNTaWSCiXFSiXDMsN+DiN+SiMHiSMTPiPOP3iNNTPiWWWiFGiIRCiSTSiSTDAiRQlLT$OOaTFTPaBF DHCPiSIDbPRaMSGsMSZlRNlRBaVC$CIDaUAPBNOAUTObSLP-DAbSLP-SCOPEsNSSEARCHiSUBNETaCLASSaSLP-NA$FQDNbACKTbARMTbAMSKaTZSTRbFQDNSbAUTHiVINESsRANKsARCHbNDIbGUIDaLDAPi6o4aPRTRbMDHCPbIPXiNIaNITAGaURLbFAILfilesnamefile+snameb-nodep-nodem-nodeh-nodeetherieee802arcnetfrelaystripieee1394 Vendor-rfc1048:?xT%u?T%u %s:[|bootp %u]DISCOVEROFFERREQUESTDECLINEACKNACKRELEASEINFORM%u?T%u%s?xT%u%s%s%d%u(%s:%s)%u%u?%02x%uERROR: options 81 len %u < 4 bytes[svrreg]%u/%u/[%s]type-%d%02x[unknown special tag %u, size %u][len %u]|[rfc1048] vend-cmu F:0x%x %s:%s %s:%s %s:%s %s:%s %s:%s %s:%s %s:%s %s:%sDevice-IDAddressPort-IDCapabilityVersion StringPlatformPrefixesProtocol-Hello optionVTP Management DomainNative VLAN IDDuplexATA-186 VoIP VLAN requestATA-186 VoIP VLAN assignmentpower consumptionMTUAVVID trust bitmapAVVID untrusted ports CoSSystem NameSystem Object ID (not decoded)Management AddressesPhysical LocationRouterTransparent BridgeSource Route BridgeL2 SwitchL3 capableIGMP snoopingL1 capable[|cdp]CDPv%u, ttl: %us, checksum: %u (unverified), length %u %s (0x%02x), length: %u byte%s: unknown field type, Device-ID '%.*s''%.*s''%.*s'(0x%08x): %snone '%.*s''%.*s'%d%sapp %d, vlan %d%1.2fW%u bytes0x%02x0x%02x'%.*s'0x%02x/%.*s , length %u[|cdp]IPv4 (%u) %spt=0x%02x, pl=%d, pb= %02x, al=%d, a= %02x IPv4 Prefixes (%d): %u.%u.%u.%u/%u[|chdlc]unicast bcast 0x%02x %d %04x: unknown CHDLC protocol (0x%04x)SLARP (length: %u), request reply %s/%skeepalive: mineseen=0x%08x, yourseen=0x%08x, reliability=0x%04x, t1=%d.%d0x%02x unknown , (trailing junk: %d bytes) [|slarp]%d: [|cip](LLC %s) NetFlow v%x, %u.%03u uptime, %u.%09u, #%u, %2u recs started %u.%03u, last %u.%03u/%u:%u %s%s%s:%u /%d:%u> %s%s%s:%u >> %s %u %s (%u<>%u encaps)tos %u, %u (%u octets) %s[|decnet][pad:%d] future-version-decnetunknown message flags under mask%s > %s %d RQR RTS IE %d hops init src %sblksize %d vers %d eco %d ueco %d hello %dverification src %s fcnval %otest src %s data %olev-1-routing src %s lev-2-routing src %s router-hello vers %d eco %d ueco %d src %s blksize %d pri %d hello %dendnode-hello vers %d eco %d ueco %d src %s blksize %d rtr %s hello %d data %ounknown control messagereserved-ntype? l2rout l1rout endnode verif blo {ids %d-%d cost %d hops %d} {areas %d-%d cost %d hops %d} reserved-ntype? l2rout l1rout endnode verif nomcast blo data %d>%d nak %d ack %d onak %d oack %d seg %d intr nak %d ack %d nakdat %d ackdat %d seg %d link-service %d>%d nak %d ack %d nakdat %d ackdat %d seg %d dat seg count %d donotsend-data send-data reserved-fcmod? %xintr req count %d reserved-fcval-int? %xreserved-subtype? %x %d > %ddata-ack %d>%d nak %d ack %d onak %d oack %d ils-ack %d>%d nak %d ack %d nakdat %d ackdat %d conn-ack %dreserved-acktype? %x %d > %dconn-initiate retrans-conn-initiate %d>%d seg msg crypt ver 3.2 ver 3.1 ver 4.0 ver 4.1 segsize %d conn-confirm %d>%d seg msg crypt ver 3.2 ver 3.1 ver 4.0 ver 4.1 segsize %d optlen %d disconn-initiate %d>%d optlen %d disconn-confirm %d>%d reserved-ctltype? %x %d > %dreserved-type? %x %d > %dobject rejected connectinsufficient resourcesunrecognized node namenode is shutting downunrecognized objectinvalid object name formatobject too busyprotocol error discoveredthird party abortuser abortinvalid node name formatlocal node shutting downinsufficient local resourcesinsufficient remote user resourcesinvalid access control informationbad ACCOUNT informationno response from objectnode unreachableno link terminatedisconnect completebad image data in connectcryptographic service mismatch%s reason-%ddnnum_string: malloc%d.%d inv_q stat op3 notify update op6 op7 op8 updataA updateD updateDA updateM updateMA zoneInit zoneRef FormErr ServFail NXDomain NotImp Refused YXDomain YXRRSet NXRRSet NotAuth NotZone Resp11 Resp12 Resp13 Resp14 NoChange\[x%02x%02x%1x/%d].../%d]ANSMDMFCNAMESOAMBMGMRNULLWKSPTRHINFOMINFOMXTXTRPAFSDBX25ISDNRTNSAPNSAP_PTRSIGKEYPXGPOSAAAALOCNXTEIDNIMLOCSRVATMANAPTRA6DNAMEOPTUINFOUIDGIDUNSPECUNSPECATKEYTSIGIXFRAXFRMAILBMAILAANYINCHAOSHSANY %sType%d (Cache flush) %s(Class %d)? (Cache flush) %s(Class %d) %sType%d %s %u %u %u %u %u %d ":%d %d %d UDPsize=%u fudge=%u maclen=%u origid=%u error=%u otherlen=%u %d%s%s%s%s%s%s [%dq] q: %d/%d/%d ns: ar: %d%s%s%s [b2&3=0x%x] [%dq] [%da] [%da] [%dq] [%dn] [%dau] ns: ar: (%d)[|domain] Probe Report Ask-neighbors(old) Neighbors(old) Ask-neighbors2 Neighbors2 Prune Graft Graft-ACK [type %d][|dvmrp] [|] Mask %s [|] [Truncated Report] %s metric %d [|} genid %u neighbor %s [%s -> %s, (%d/%d)] (v %d.%d): [%s -> %s (%d/%d/tunnel/srcrt/querier/disabled/down)] [|] src %s grp %s timer src %s grp %s src %s grp %s[|enc](unprotected): (%s%s%s%sSPI 0x%08x: requestconfirmrefuseceasecease_ackunspecifiedactive_modepassive_modeinsufficient_resourcesadministratively_prohibitedgoing_downparameter_violationprotocol_violationhelloi-h-uindeterminateupdownunspecifiedbad_EGP_header_formatbad_EGP_data_field_formatreachability_info_unavailableexcessive_polling_rateno_responseunsupported_version %s %s %sd%d:, %s[|][|egp]egp: [version %d]as:%d seq:%d acquire %s %s [status %d] hello:%d poll:%d %s %s[status %d][code %d] %s state:%s [status %d][reach code %d] poll state:%s [status %d] net:%s update unsolicited state:%s [status %d] %s int %d ext %d error state:%s [status %d] %s [reason %d][type %d][|ESP]ESP(spi=0x%08x,seq=0x%x)IPv4MPLS unicastMPLS multicastIPv6802.1QVMANPUPARPReverse ARPNSSpriteTrailMOP DLMOP RCDNLATSCALanbridgeDEC DNSDEC DTSVEXPVPRODAppletalkAppletalk ARPIPXPPPPPPoE DPPPoE SLoopback%s > %s, 802.3, ethertype %s (0x%04x)Unknown, 802.3, %sUnknown Ethertype (0x%04x), length %u: [|ether]et1 (NOV-ETHII) vlan %u, p %u%s, ethertype %s, 0x%04x: void nrt rt info nsa beacon claim mac%1x smt%1x async%1x sync%1x imp_async%1x imp_sync%1x %02x %02x %s %s %d: %s %s %d: %s %s %d: [|fddi](LLC %s) FECN, BECN, DE, %sdlcore %xLMICisco LMISNAPCLNPESISISISCONSIDRPX25_ESISIPproto %02xDLCI %u, %s%slength %d: DLCI %u, %s%s%s, length %d: [|fr]Invalid Q.922 address[|fr]UI %02x! Pad! No pad! (SNAP %s) Invalid DLCI IEDLCI %d: status %s%s[|lmi] Call Ref: %02x! STATUS REPLY STATUS ENQUIRY UNKNOWN MSG Type %02x [|lmi][|lmi]FULL STATUSLINK VERIFYAsync PVC StatusReserved ValueTX Seq: %3d, RX Seq: %3dNon-decoded Value IE: %02X Len: %d, %s [|gre]gre-unknown-version=%u[%s%s%s%s%s] sum 0x%x off 0x%x key=0x%x seq %u gre-proto-0x%x[|gre][%s%s%s%s%s%s] cpset!rpset!kpunset!spset!call %d seq %u ack %u no-payloadgre-ppp-payloadgre-proto-0x%x[|gre](rtaf=ip) (rtaf=asn) (rtaf=0x%x) badoffset=%u badlength=%u badoff/len=%u/%u %s%s badoffset=%u badlength=%u badoff/len=%u/%u %s%xhellocoupresigninitiallearnlistenspeakstandbyactiveHSRPv%d-%s unknown (%d)%d: state=%s Unknown (%d)group=%d [reserved=%d!] addr=%s hellotime= holdtime= priority=%d auth=""[|hsrp]echo replysource quenchecho requestrouter solicitationtime stamp requesttime stamp replyinformation requestinformation replyaddress mask requestnet %s unreachablehost %s unreachable%s unreachable - source route failednet %s unreachable - unknownhost %s unreachable - unknown%s unreachable - source host isolatednet %s unreachable - admin prohibitedhost %s unreachable - admin prohibitednet %s unreachable - tos prohibitedhost %s unreachable - tos prohibitedhost %s unreachable - admin prohibited filterhost %s unreachable - host precedence violationhost %s unreachable - precedence cutoffredirect %s to net %sredirect %s to host %sredirect-tos %s to net %sredirect-tos %s to host %secho %s seq %u%s protocol %d unreachable%s tcp port %s unreachable%s udp port %s unreachable%s protocol %d port %d unreachable%s unreachable - need to frag (mtu %d)%s unreachable - need to frag#%d %%s unreachableredirect-#%d %%s to net %%srouter advertisement lifetime %u%u:%02u%u:%02u:%02u %d: [size %d] {%s %u}time exceeded in-transitip reassembly time exceededtime exceeded-#%dparameter problem - code %dparameter problem - octet %daddress mask is 0x%08xtime stamp query id %u seq %utime stamp reply id %u seq %u : org 0x%x recv 0x%x xmit 0x%xtype-#%dicmp %d: %s (wrong icmp cksum %x (->%x)!) for [|icmp]is_inis_exto_into_exallowblock [invalid len %d]mtrace %u: %s to %s reply-to %s with-ttl %d[|igmp] [invalid len %d]mresp %lu: %s to %s reply-to %s with-ttl %d[|igmp] [invalid len %d], %d group record(s) [invalid number of groups] [gaddr %s %s [v3-report-#%d] [invalid number of sources %d], %d source(s) { %s }][|igmp] v3 [invalid len %d] [max resp time ] [gaddr %s [invalid number of sources] { %s }, %d source(s)][|igmp]igmpigmp query v2 [max resp time %d] v1 [gaddr %s] [len %d]igmp v1 report %s [len %d]igmp v2 report %sigmp v3 reportigmp leave %sigmp dvmrp [len %d]igmp pimv1igmp-%d bad igmp cksum %x![|igmp] *.%d.%d.%d X%d.%d.%d.0 %d.%d.%d.0 d=%d b=%d r=%d l=%d M=%d mtu=%d in %d hopsupdaterequestigrp: %s V%d edit=%d AS=%d (%d/%d/%d)op-#%d [extra bytes %d] [|igrp] [bad length %u] %s{ [bad length %u] [bad ptr %u]#%s%s %s}[bad length %d] TS{[bad length %d][bad ptr %d]TSONLYTS+ADDRPRESPEC2.0PRESPEC[bad ts type %d] ^ %s%d@%s %s [%d hops not recorded]} }[|ip op len %d] EOL-%d NOP SECURITY{%d}RRSSRRLSRR RA{%d}%d.%d IPOPT-%d{%d}[|ip]+DFrsvdIP%u , wrong link-layer encapsulationIP [|ip]truncated-ip %dbad-hlen %utruncated-ip - %u bytes missing! bad-len %u(tos 0x%x,ECT(1),ECT(0),CE, ttl %3u, id %u, offset %u, flags [%s]none, length: %u, optlength: %u ( ), bad cksum %x (->%x)!) %s > %s: nd %d (ipip-proto-4) %s ip-proto-%d %d%s > %s: %s ip-proto-%dtruncated-ip %dunknown ip %d[|IPCOMP]IPComp(cpi=0x%04x)%s %s %d: [|ipfc](LLC %s) %s.%04x > %s.%04x:[|ipx %d]%08x.%02x:%02x:%02x:%02x:%02x:%02x ipx-ncp %d ipx-netbios %d ipx-diags %d ipx-nwlink-dgm %d ipx-eigrp %d ipx-#%x %dipx-sap-reqipx-sap-nearest-req %sipx-sap-respipx-sap-nearest-resp %s '' addr %sipx-sap-?%x[|ipx %d]ipx-rip-req %u/%d.%dipx-rip-resp %u/%d.%dipx-rip-?%x[|ipx %d]isakmpipsec-ahipsec-espipcompnonesaptkeidcertcrhashsignoncendvidnonebaseidentauthagginfoakley-quickoakley-newgroup%02x[|attr](type=%s type=#%d value=%slen=%d value=)[|attr](type=#%d value=len=%d value=)%s: doi=%d situation=%u doi=ipsec situation=identity%ssecrecy%sintegrity ident=%u [|%s]%s: #%d protoid=%s transform=%d spi= [|%s]ike(reserved)md5sha1dessha2-256sha2-384sha2-5121des-iv641des3desrc5ideacastblowfish3idea1des-iv32rc4nullaesouideflatelzslifetypeseckblifegroup descmodp768modp1024EC2N 2^155EC2N 2^185enc modetunneltransportauthhmac-md5hmac-sha11des-mackeyedkeylenroundsdictsizeprivalgenc1desideablowfishrc53descastaeshashmd5sha1tigersha2-256sha2-384sha2-512authpreshareddssrsa sigrsa encrsa enc revisedgroup descmodp768modp1024EC2N 2^155EC2N 2^185group typeMODPECPEC2Ngroup primegroup gen1group gen2group curve Agroup curve Blifetypeseckblifedurationprfkeylenfieldorder%s: #%d id=%s #%d id=%d ... [|%s]%s: key len=%d [|%s]IPv4IPv4netIPv6IPv6netIPv4FQDNuser FQDNIPv4netIPv6IPv6netIPv4rangeIPv6rangeASN1 DNASN1 GNkeyid%s: idtype=%s doi_data=%u idtype=%s protoid=%s protoid=%s port=%d len=%d [bad: < 4] len=%d %s len=%d len=%d [bad: < 8] len=%d %s/%u.%u.%u.%u len=%d [bad: < 8] len=%d %s-%s len=%d [|%s]nonepkcs7pgpdnsx509signx509kekerberoscrlarlspkix509attr%s: len=%d type=%s [|%s]nonepkcs7pgpdnsx509signx509kekerberoscrlarlspkix509attr%s: len=%d type=%s [|%s]%s: len=%d [|%s]%s: len=%d [|%s]%s: n len=%d [|%s]INVALID-PAYLOAD-TYPEDOI-NOT-SUPPORTEDSITUATION-NOT-SUPPORTEDINVALID-COOKIEINVALID-MAJOR-VERSIONINVALID-MINOR-VERSIONINVALID-EXCHANGE-TYPEINVALID-FLAGSINVALID-MESSAGE-IDINVALID-PROTOCOL-IDINVALID-SPIINVALID-TRANSFORM-IDATTRIBUTES-NOT-SUPPORTEDNO-PROPOSAL-CHOSENBAD-PROPOSAL-SYNTAXPAYLOAD-MALFORMEDINVALID-KEY-INFORMATIONINVALID-ID-INFORMATIONINVALID-CERT-ENCODINGINVALID-CERTIFICATECERT-TYPE-UNSUPPORTEDINVALID-CERT-AUTHORITYINVALID-HASH-INFORMATIONAUTHENTICATION-FAILEDINVALID-SIGNATUREADDRESS-NOTIFICATIONNOTIFY-SA-LIFETIMECERTIFICATE-UNAVAILABLEUNSUPPORTED-EXCHANGE-TYPEUNEQUAL-PAYLOAD-LENGTHSRESERVEDCONNECTEDRESPONDER-LIFETIMEREPLAY-STATUSINITIAL-CONTACT%s: doi=%d proto=%d type=%s type=%s type=%s type=%s spi= doi=ipsec proto=%s type=%s type=%s type=%s type=%s type=%s spi= orig=(replay detection %sabled) [|%s]%s: doi=%u proto=%u doi=ipsec proto=%s spilen=%u nspi=%u spi=, [|%s]%s: len=%d [|%s]%s [|isakmp] () [|%s]#%d[|isakmp]isakmp %d.%d msgid cookie ->: phase %d phase %d/others I ? I R ? %s[%s%s]: [encrypted %s] [|%s] (len mismatch: isakmp %u/ip %u)L1 Lan IIHL2 Lan IIHp2p IIHL1 LSPL2 LSPL1 CSNPL2 CSNPL1 PSNPL2 PSNPArea address(es)IS ReachabilityES Neighbor(s)Partition DISPrefix NeighborsIS Neighbor(s)IS Neighbor(s) (variable length)PaddingLSP entriesAuthenticationChecksumLSP BuffersizeExtended IS ReachabilityIS Alias IDDECnet Phase IVLucent ProprietaryIPv4 Internal ReachabilityProtocols supportedIPv4 External ReachabilityInter-Domain Information TypeIPv4 Interface address(es)IPv4 authentication (deprecated)Traffic Engineering Router IDExtended IPv4 ReachabilityHostnameShared Risk Link GroupNortel ProprietaryNortel ProprietaryHoldtimeRestart SignalingMulti Topology IS ReachabilityMulti TopologyIPv6 Interface address(es)Multi-Topology IPv4 ReachabilityIPv6 reachabilityMulti-Topology IP6 ReachabilityPoint-to-point Adjacency StateHello PDU Sequence NumberVendor PrivateAdministrative groupsLink Local/Remote IdentifierLink Remote IdentifierIPv4 interface addressIPv4 neighbor addressMaximum link bandwidthReservable link bandwidthUnreserved bandwidthTraffic Engineering MetricLink Protection TypeInterface Switching CapabilityReserved for cisco specific extensionsReserved for cisco specific extensionsReserved for cisco specific extensionsReserved for cisco specific extensionsReserved for cisco specific extensionsReserved for future expansion32-Bit Administrative tag64-Bit Administrative tagsimple text passwordHMAC-MD5 passwordRouting Domain private passwordReservedRouting-Domain SpecificAS Number Tagsub-TLVs presentATT bit setIPv4 unicastIn-Band ManagementIPv6 unicastMulticastDevelopment, Experimental or ProprietaryLevel 1 onlyLevel 2 onlyLevel 1, Level 2Unused 0x0 (invalid)L1 ISUnused 0x2 (invalid)L1L2 ISCLNSIPv4IPv6UpInitializingDownIsNotVirtualIsVirtualRestart RequestRestart Acknowledgementillegal length%02x%sOSI, CLNS, length %u , ISO NULLNS, length: %u, Unknown NLPID 0x%02x, length: %u redirectESHISH bad pkt! no header at all! bad pkt! LI(%d) > PDU size (%d)! bad pkt! too short for esis header %d:%02X, ES-IS, %s, length %uunknown type: %u bad cksum (got 0x%02x%02x) unsupported version %d %s [bad li] > %s > %s [bad li] NET: %s , bad opts/li, opt (%d) too long holdtime: %us %s (length: %u): %sunknownUnknown 0x%02x %02x.%02x-%02x, Default Metric: %d, %s Delay Metric: %d, %s Expense Metric: %d, %s Error Metric: %d, %sshort IPv4 Reachability (%d vs %lu)%sIPv4 prefix: %s mask %s%sIPv4 prefix: %15s/%u, Distribution: %s, Metric: %u, %s%s Delay Metric: %u, %s%s Expense Metric: %u, %s%s Error Metric: %u, %s%s%s subTLV #%u, length: %uunknown, 0x%08x (=%u), 0x%08x%08x %spacket exceeded snapshot%s%s subTLV #%u, length: %uunknown, 0x%08x, 0x%08x, %s, %.3f Mbps%s priority level %d: %.3f Mbps, %u, %s, Priority %unone%s Interface Switching Capability:%sUnknown, LSP Encoding: %sUnknown%s Max LSP Bandwidth:%s priority level %d: %.3f Mbps %spacket exceeded snapshot%sIS Neighbor: %s, Metric: %d, %ssub-TLVs present (%u)%s %s%sReserved for IETF Consensus Topology (0x%03x), Flags: [%s]none%sIPv4 prefix: %15s/%u, Distribution: %s, Metric: %u, sub-TLVs present (%u)%s , version %d packet not supported, system ID length of %d is not supported, version %d packet not supported, bad packet -- 255 areas, bad packet -- illegal sys-ID length (%u), IS-IS, %sunknown PDU-Type %u, src-id %s, lan-id %s, prio %u, src-id %s, lsp-id %s, seq 0x%08x, lifetime %5us, src-id %s, src-id %s, length %u, IS-IS, length: %u %s, hlen: %u, v: %u, pdu-v: %u, sys-id-len: %u (%u), max-area: %u (%u)unknown, type %u , bogus fixed header length %u should be %lu source-id: %s, holding time: %us, Flags: [%s]unknown circuit type 0x%02x lan-id: %s, Priority: %u, PDU length: %u , bogus fixed header length %u should be %lu source-id: %s, holding time: %us, Flags: [%s]unknown circuit type 0x%02x circuit-id: 0x%02x, PDU length: %u , bogus fixed header length %u should be %lu lsp-id: %s, seq: 0x%08x, lifetime: %5us chksum: 0x%04x (purged) (%s), PDU length: %u, Flags: [ %s%s%s%s%sATT bit set, %s%s ]Unknown(0x%x) , bogus fixed header length %u should be %lu source-id: %s, PDU length: %u start lsp-id: %s end lsp-id: %s - bogus fixed header length %u should be %lu source-id: %s, PDU length: %u packet exceeded snapshot (%ld) bytes %s TLV #%u, length: %uunknown Area address (length: %u): %s SNPA: %s LAN address length %u bytes IS Neighbor: %s %sbogus virtual flag 0x%02x IS Neighbor: %s ES Neighbor: %s %s: unknown Authentication type 0x%02x%c%02x, (malformed subTLV) Adjacency State: %s (%u)unknown Extended Local circuit-ID: 0x%08x Neighbor System-ID: %s Neighbor Extended Local circuit-ID: 0x%08x NLPID(s): %s (0x%02x)unknown, Traffic Engineering Router ID: %s IPv4 interface address: %s Hostname: %c IS Neighbor: %s, Flags: [%s] IPv4 interface address: %s IPv4 neighbor address: %s Link-ID: 0x%08x lsp-id: %s, seq: 0x%08x, lifetime: %5ds, chksum: 0x%04x checksum: 0x%04x (unverified)(%s) malformed MT-ID Flags [%s], Remaining holding time %usnone Inter-Domain Information Type: %sUnknown (0x%02x)AS Number: %u LSP Buffersize: %u %s Metric Block Address: %s/%u Sequence number: %u Vendor OUI Code: 0x%06x %u straggler bytes[|isis] packet exceeded snapshotKDC_REQUESTKDC_REPLYAPPL_REQUESTAPPL_REQUEST_MUTUALERR_REPLYPRIVATESAFEAPPL_ERRDIEOKNAME_EXPSERVICE_EXPAUTH_EXPPKT_VERNAME_MAST_KEY_VERSERV_MAST_KEY_VERBYTE_ORDERPRINCIPAL_UNKNOWNPRINCIPAL_NOT_UNIQUENULL_KEY %s %s: %dmin v%d (%d) (%d) (%d) %s (unknown) v%d v%d v5SCCRQSCCRPSCCCNStopCCNHELLOOCRQOCRPOCCNICRQICRPICCNCDNWENSLIMSGTYPERESULT_CODEPROTO_VERFRAMING_CAPBEARER_CAPTIE_BREAKERFIRM_VERHOST_NAMEVENDOR_NAMEASSND_TUN_IDRECV_WIN_SIZECHALLENGEQ931_CCCHALLENGE_RESPASSND_SESS_IDCALL_SER_NUMMINIMUM_BPSMAXIMUM_BPSBEARER_TYPEFRAMING_TYPEPACKET_PROC_DELAYCALLED_NUMBERCALLING_NUMBERSUB_ADDRESSTX_CONN_SPEEDPHY_CHANNEL_IDINI_RECV_LCPLAST_SENT_LCPLAST_RECV_LCPPROXY_AUTH_TYPEPROXY_AUTH_NAMEPROXY_AUTH_CHALPROXY_AUTH_IDPROXY_AUTH_RESPCALL_ERRORSACCMRANDOM_VECTORPRIVATE_GRP_IDRX_CONN_SPEEDSEQ_REQUIREDPPP_DISCON_CCReservedTextualCHAPPAPNo AuthMS-CHAPv1global errorat peerat local%c%02x%u%lu%sMSGTYPE-#%u%u/%u %u.%uASAD, %02x ADASobsolete%sAuthType-#%u%uCRCErr=%u FrameErr=%u HardOver=%u BufOver=%u Timeout=%u AlignErr=%u send=%08x recv=%08x %04x, %04x %sDirection-#%u *?VENDOR%04x:ATTR%04x()%sAVP-#%u(???)|... l2tp: l2f: Unknown Version, neither L2F(1) nor L2TP(2)[TLSOP](%u/%u)Ns=%u,Nr=%u ZLB {}%sconfigure requestconfigure responsejoin requestjoin responseready queryready indicationregister requestregister responseunregister requestunregister responseARP requestARP responseflush requestflush responseNARP requesttopology requestlecid:%x %s %s %d: lecid:%x %s %s %s %d: [|lane]lec: proto %x vers %x %sopcode-#%u[|lane](LLC %s) NotificationHelloInitializationKeepaliveAddressAddress WidthdrawLabel MappingLabel RequestLabel WithdrawLabel ReleaseLabel Abort RequestFECAddress ListHop CountPath VectorGeneric LabelATM LabelFrame-Relay LabelStatusExtended StatusReturned PDUReturned MessageCommon Hello ParametersIPv4 Transport AddressConfiguration Sequence NumberIPv6 Transport AddressCommon Session ParametersATM Session ParametersFrame-Relay Session ParametersLabel Request Message ID %s TLV (0x%04x), length: %u, Flags: [%s and %s forward if unknown]Unknown Hold Time: %us, Flags: [%s Hello%s] IPv4 Transport Address: %s Sequence Number: %u LDP version %u packet not supported%sLDP, Label-Space-ID: %s:%u, length: %u %s Message (0x%04x), length: %u, Message ID: 0x%08x, Flags: [%s if unknown]Unknown packet exceeded snapshotNullGlobal802.1B I802.1B GIPProWay NMSTPRS511ISO8208ProWaySNAPIPXNetBeuiOSIuitestxiduadiscdmsabmefrmr[|llc]LLC, dsap %s (0x%02x), ssap %s (0x%02x), cmd 0x%02x, UnknownUnknown(NOV-802.3) (NOV-802.2) [|llc-snap]%s %s > %s %s %s > %s %s %s > %s %s %02x%s/%c: %02x %02xrrrejrnr03%s (r=%d,%c)I (s=%d,r=%d,%c) len=%dnoopgetaddrsbynamegetnamebyaddrgetrdatabyname %02x %s %u/%02x lwres v%u#0x%x %s%s[0x%x] (serial:0x%x result:0x%x recvlen:%u authtype:0x%x authlen:%u) flags:0x%x IPv4 IPv6 IPv4/6[0x%x] flags:0x%x flags:0x%x %sType%d %sClass%d flags:0x%x %u/%u flags:0x%x %u flags:0x%x %sType%d %sClass%d TTL %u/%u [len: %u != %u][extra][|lwres][|mobile]mobile: [S] %s [] > %s (oproto=%d) (bad checksum %d)IPv4 explicit NULLrouter alertIPv6 explicit NULLimplicit NULLrsvdrsvdrsvdrsvdrsvdrsvdrsvdrsvdrsvdrsvdrsvdrsvdMPLS (label %u (%s), exp %u, [S], ttl %u) , IP, length: %u , OSI, length: %u[|MPLS]UDP, LSP-PING, length: %u msdp: [len %u] SA SA-Response %u entries [w/data] SA-Request for %s Keepalive[len=%d] Notification [type=%d len=%d] [|msdp]Operation not permittedNo such file or directoryInput/output errorDevice not configuredResource deadlock avoidedCannot allocate memoryPermission deniedFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentText file busyFile too largeNo space left on deviceRead-only file systemToo many linksOperation not supportedToo many levels of symbolic linksFile name too longDirectory not emptyDisc quota exceededStale NFS file handleToo many levels of remote in pathWrite cache flushed to diskIllegal NFS file handleUpdate synchronization mismatchREADDIR/READDIRPLUS cookie is staleOperation not supportedBuffer or request is too smallUnspecified error on serverObject of that type not supportedRequest couldn't be completed in timeunstabledatasyncfilesyncNONREGDIRBLKCHRLNKFIFO0x%x%08x0x%x??%s.%s > %s.%s: mode %o uid %u gid %u atime %u.%06u mtime %u.%06unfs%u%u%ureply %s %d%unfs%u%u%d nop null getattr setattr lookup access %04x readlink read %u bytes @ %u bytes @ %u write %u bytes @ <%s> %u (%u) bytes @ %u (%u) create mkdir symlink -> mknod %sunk-ft %d %u/%u remove rmdir rename -> link -> readdir %u bytes @ verf %08x%08x %u bytes @ %d readdirplus %u bytes @ max %u verf %08x%08x fsstat fsinfo pathconf commit %u bytes @ proc-%u [|nfs] fh[%s%x:] fh %s/ fh %d,%d/%s%ld PROG_UNAVAIL PROG_MISMATCH PROC_UNAVAIL GARBAGE_ARGS SYSTEM_ERR ar_stat %d ERROR: %sunk %d %s %o ids %d/%dunk-ft %d sz sz %d nlink %d rdev %d/%d fsid fileid a/m/ctime %u.%06u %u.%06u %u.%06u nlink %d rdev %x fsid %x nodeid %x a/m/ctime %u.%06u %u.%06u %u.%06u POST: tbytes fbytes abytes tfiles ffiles afiles invar %u tsize %d bsize %d blocks %d bfree %d bavail %d offset %x size %d eof sz mtime %u.%06u ctime %u.%06u PRE: POST: dir attr: POST: verf %08x%08x POST: rtmax %u rtpref %u wtmax %u wtpref %u dtpref %u rtmult %u wtmult %u maxfsz delta %u.%06u POST: linkmax %u namemax %u %s %s %s %s nop null getattr setattr lookup post dattr: post dattr: access attr: c %04x readlink read %u bytes EOF write %u bytes <%s> create mkdir symlink mknod remove rmdir rename from: to: link file POST: dir: readdir readdirplus fsstat fsinfo pathconf commit proc-%u [|nfs] [len=%d]NTPv%d +1s -1s unspec sym_act sym_pas client server bcast res1 res2, strat %d, poll %d, prec %d dist , disp , ref (unspec)%s INFO_QUERY%s INFO_REPLY%s orig rec xmt [|ntp]%d.%06d%u.%09d%Y/%m/%d %H:%M:%S (%s)%d.%09dAF %u ip ns osi atalk ipx AF %u %d: [|null]TOSExternalMulticastNSSAAdvertise ExternalDemand CircuitOpaquenonesimpleMD5ABRASBRVirtualW2UMDHelloDatabase DescriptionLS-RequestLS-UpdateLS-AckRouterNetworkSummaryASBR SummaryExternalMulticast GroupNSSALink Local OpaqueArea Local OpaqueDomain Wide OpaqueInitMoreMasterTraffic EngineeringGraceful restartRouter AddressLinkLink TypeLink IDLocal Interface IP addressRemote Interface IP addressTraffic Engineering MetricMaximum BandwidthMaximum Reservable BandwidthUnreserved BandwidthAdministrative GroupLink Local/Remote IdentifierLink Protection TypeInterface Switching CapabilityShared Risk Link GroupPoint-to-pointMulti-Access Bogus length %u < %lu Advertising Router: %s, seq 0x%08x, age %us, length: %u %s LSA (%d), Opaque-Type: %s LSA (%u), Opaque-ID: %uunknownunknown %s LSA (%d), LSA-ID: %sunknown Options: [%s]none Router LSA Options: [%s]none Virtual Link: Neighbor Router-ID: %s, Interface Address: %s Neighbor Router-ID: %s, Interface Address: %s Neighbor Network-ID: %s, Interface Address: %s Stub Network: %s, Mask: %s Unknown Router Link Type (%u), tos 0, metric: %d, tos %d, metric: %d Mask %s Connected Routers: %s Mask %s, metric: %u, tos %d metric %d, metric: %u, tos %d metric %d Mask %s, type %d, tos %d metric: infinite %d, forward %s, tag %s Router Router-ID %s Network Designated Router %s unknown VertexType (%u) Remaining LS length %u < 4 %s TLV (%u), length: %uunknown Bogus length %u > %u Remaining TLV length %u < 4 %s subTLV (%u), length: %uunknown, 0x%08x, %s (0x%08x), %s (0x%08x), %s, %.3f Mbps priority level %d: %.3f Mbps, Metric %u, %s, Priority %unone Interface Switching Capability: %sUnknown LSP Encoding: %s Max LSP Bandwidth:Unknown priority level %d: %.3f Mbps, %s (%u)unknown Shared risk group: %d, TLV length %u < 4, %s Options: [%s]none Hello Timer: %us, Dead Timer %us, Mask: %s, Priority: %u Designated Router %s, Backup Designated Router %s Neighbor List: %s Options: [%s]none, DD Flags: [%s]none Advertising Router: %s, %s LSA (%u)unknown, Opaque-Type: %s LSA (%u), Opaque-ID: %uunknown, LSA-ID: %s, %d LSA%s LSA #%uv2 type (%d)unknown LS-typeOSPFv%u, %s (%u), length: %u [len %d] Router-ID: %s, Area %s, Backbone Area, Authentication Type: %s (%u)unknown" Key-ID: %u, Auth-Length: %u, Crypto Sequence Number: 0x%08x ospf [version %d]0(match)1(bad-offset)2(fragment)3(short)4(normalize)5(memory)passblockscrubnatnatbinatbinatrdrrdrsynproxy-dropin/outinoutrule %u/rule %u.%s.%u/%s: %s %s on %s: unkn(%u)unkn(%u)unkn(%u)[|pflog][pflog: invalid header length!][|pflog][|pflog] RPF %s Hold %s (%s/%d, %s/%s) %s%s %s Upstream Nbr: %s Hold time: Group: %s/%s joined: %d pruned: %dJoin Prune %s %s%s%s%s/%d[|pim] Query Dense-mode Sparse-mode Sparse-Dense-mode mode-%d (Hold-time ) Register for %s > %s Register-Stop for %s > %s Join/Prune RP-reachable group %s/%s RP %s hold Assert for %s > %s/%s %s pref %d metric %d Graft Graft-ACK Mode [type %d] [v%d][|pim] auto-rp candidate-advertmappingtype-0x%02x Hold FOREVER RP %s PIMv? PIMv1 PIMv2 PIMv1+2 [rsvd=0x%02x]%c%s%s/%d[rsvd=0x%02x][|autorp]pim v2pim v%dIPv4IPv4%s%s/%u(0x%02x)(%s%s%s+0x%02x)[RFC2117-encoding] Hello (Hold-time ) (LAN-Prune-Delay: !olen=%d!)T-bit=%d lan-delay=%dms override-interval=%dms) (OLD-DR-Priority: %d) (OLD-bidir-capable) (DR-Priority: !olen=%d!)%d) (Genid: 0x%08x) (State Refresh Capable; v%d interval ?0x%04x?) (bidir-capable) (%saddr-list ...) [Hello option %d] Register %s%s IP ver %d Register-Stop group=... source=... Join/Prune Graft Graft-ACK upstream-neighbor=... groups=%u holdtime=infty (group%d: ...)...) join=%u ...) prune=%u ...)) Bootstrap tag=%x hashmlen=%d BSRprio=%d BSR=... (group%d: ...)...) RPcnt=%d...) FRPcnt=%d RP%d=...)...),holdtime=...),prio=%d) Assert group=... src=... RPT pref=%u metric=%u Candidate-RP-Advertisement prefix-cnt=%d prio=%d holdtime= RP=... Group%d=... Prune-Refresh src=... grp=... forwarder=... TUNR [type %d][|pim]IPOSINSDECNETAPPLEIPXVJCVJNCBRPDUSTIIVINESMPLSMPLSHELLOLUXCOMSNSIPCPOSICPNSCPDECNETCPAPPLECPIPXCPSTIICPVINESCPMPLSCPLCPPAPLQMCHAPBACPBAPMLVendor-ExtensionConf-RequestConf-AckConf-NackConf-RejectTerm-RequestTerm-AckCode-RejectProt-RejectEcho-RequestEcho-ReplyDisc-ReqIdentTime-RemReset-ReqReset-AckVend-ExtMRUACCMAuth-ProtQual-ProtMagic-Numdeprecated(6)PFCACFCFCS-AltSDPNum-Modedeprecated(12)Call-Backdeprecated(14)deprecated(15)deprecated(16)MRRUSSNHFEnd-DiscProprietaryDCE-IdMP+Link-DiscLCP-Auth-OptCOBSPrefix-elisionMultilink-header-FormI18NSDL-over-SONET/SDHPPP-MuxingOUIPred-1Pred-2Puddleunassigned(4)unassigned(5)unassigned(6)unassigned(7)unassigned(8)unassigned(9)unassigned(10)unassigned(11)unassigned(12)unassigned(13)unassigned(14)unassigned(15)HP-PPCStac-LZSMPPCGand-FZAV.42bisBSD-Compunassigned(22)LZS-DCPMVRCADECDeflateChalRespSuccFailAuth-ReqAuth-AckAuth-Nakunknown%s, %s (0x%02x), id %uUnknown Opcode, Magic-Num 0x%08x OUI 0x%06x, Rejected %s Protocol (0x%04x)unknown, Magic-Num 0x%08x, Magic-Num 0x%08x, Seconds-Remaining %us , length %u [|%s], %s , unknown LCP option 0x%02x OUI 0x%06x %u %08x PAP CHAP, unknown-algorithm-%u, MD5, MSCHAPv1, MSCHAPv2 EAP SPAP Old-SPAPunknown LQR unknown 0x%08x 0x%04x UserAuth DialString LocalID E.164 X.500 CBCP unknown-operation=%u %u Null Local IPv4 %s MAC %02x:%02x:%02x:%02x:%02x:%02x Magic-Num-Block PSNDN[|lcp][|chap][|chap 0x%02x]%s0x%02x(%u), Value %02x, Name , Msg [|chap][|pap][|pap 0x%02x]%s0x%02x(%u), Peer , Name , Msg [|pap], IP-Addrs src %s, dst %s, IP-Comp VJ-Comp unknown-comp-proto=%04x, IP-Addr %s, Home-Addr %s, Pri-DNS %s, Pri-NBNS %s, Sec-DNS %s, Sec-NBNS %s, unknown-%d, invalid-length-%d[|ipcp], %s[|ccp], Favored-Peer, Magic-Num 0x%08x, unknown-option-%d[|bacp]unknown PPP protocol (0x%04x) PPP-%s (0x%04x), length %u: unknown[|ppp][|ppp][|ppp][|ppp]%02x %02x %d %s: unknown PPP protocol (0x%04x)%02x %02x %d unknown addr %02x; ctrl %02xPADIPADOPADRPADSPADTEOLService-NameAC-NameHost-UniqAC-CookieVendor-SpecificRelay-Session-IDService-Name-ErrorAC-System-ErrorGeneric-Error truncated PPPoE [ver %d] [type %d]PPPoE %sPAD-%x [len %d!] [ses 0x%x] [length %d (%d extra bytes)] [%s "%*.*s"]TAG-0x%x [%s 0xTAG-0x%x%02X] [%s]TAG-0x%x [|pppoe]NOT_DEFINEDSCCRQSCCRPStopCCRQStopCCRPECHORQECHORPOCRQOCRPICRQICRPICCNCCRQCDNWENSLI BEARER_CAP(DA) BEARER_TYPE(ADAny?) CALL_ID(%u) CALL_SER_NUM(%u) CAUSE_CODE(%u) CONN_SPEED(%u) ERR_CODE(%u:None:Not-Connected:Bad-Format:Bad-Valude:No-Resource:Bad-Call-ID:PAC-Error:?) FIRM_REV(%u) FRAME_CAP(AS) FRAME_TYPE(ASE?) HOSTNAME(%.64s) ID(%u) MAX_CHAN(%u) PEER_CALL_ID(%u) PHY_CHAN_ID(%u) PROC_DELAY(%u) PROTO_VER(%u.%u) RECV_WIN(%u) RESULT_CODE(%u:Successful channel establishment:General error:Command channel already exists:Requester is not authorized to establish a command channel:The protocol version of the requester is not supported:?:OK:General Error:?:Connected:General Error:No Carrier:Busy:No Dial Tone:Time-out:Do Not Accept:?:Connect:General Error:Do Not Accept:?:Lost Carrier:General Error:Admin Shutdown:Request:?) SUB_ADDR(%.64s) VENDOR(%.64s)%s%s REASON(%u:None:Stop-Protocol:Stop-Local-Shutdown:?)%s%s%s%s MIN_BPS(%u) MAX_BPS(%u) PHONE_NO_LEN(%u) PHONE_NO(%.64s)%s%s DIALED_NO_LEN(%u) DIALING_NO_LEN(%u) DIALED_NO(%.64s) DIALING_NO(%.64s)%s%s%s%s CALL_STATS(%.128s)%s CRC_ERR(%u) FRAMING_ERR(%u) HARDWARE_OVERRUN(%u) BUFFER_OVERRUN(%u) TIMEOUT_ERR(%u) ALIGN_ERR(%u)%s SEND_ACCM(0x%08x) RECV_ACCM(0x%08x)%s: pptp Length=%u CTRL-MSG MGMT-MSG UNKNOWN-MSG-TYPE UNEXPECTED Magic-Cookie!!(%08x) Magic-Cookie=%08x CTRL_MSGTYPE=%s UNKNOWN_CTRL_MSGTYPE(%u)%sAccess RequestAccess AcceptAccess RejectAccounting RequestAccounting ResponseAccess ChallengeStatus ServerStatus ClientReservedLoginFramedCallback LoginCallback FramedOutboundAdministrativeNAS PromptAuthenticate OnlyCallback NAS PromptCall CheckCallback AdministrativePPPSLIPARAPGandalf proprietaryXylogics IPX/SLIPX.75 SynchronousNoneSendListenSend&ListenNoneVJ TCP/IPIPXStac-LZSTelnetRloginTCP ClearPortMaster(proprietary)LATX.25-PADX.25-T3POSUnassignedTCP Clear QuietDefaultRADIUS-RequestAsyncSyncISDN SyncISDN Async V.120ISDN Async V.110VirtualPIAFSHDLC Clear ChannelX.25X.75G.3 FaxSDSLADSL-CAPADSL-DMTISDN-DSLEthernetxDSLCableWireless - OtherWireless - IEEE 802.11StartStopInterim-UpdateUnassignedUnassignedUnassignedAccounting-OnAccounting-OffTunnel-StartTunnel-StopTunnel-RejectTunnel-Link-StartTunnel-Link-StopTunnel-Link-RejectFailedRADIUSLocalRemoteUser RequestLost CarrierLost ServiceIdle TimeoutSession TimeoutAdmin ResetAdmin RebootPort ErrorNAS ErrorNAS RequestNAS RebootPort UnneededPort PreemptedPort SuspendedService UnavailableCallbackUser ErrorHost RequestPPTPL2FL2TPATMPVTPAHIP-IPMIN-IP-IPESPGREDVSIP-in-IP TunnelingIPv4IPv6NSAPHDLCBBN 1822802E.163E.164F.69X.121IPXAppletalkDecnet IVBanyan VinesE.164 with NSAP subaddressOnly access to dfl zoneUse zone filter inc.Not usedUse zone filter exc.No EchoEchoUsernamePasswordCHAP PasswordNAS IP AddressNAS PortService TypeFramed ProtocolFramed IP AddressFramed IP NetworkFramed RoutingFilter IDFramed MTUFramed CompressionLogin IP HostLogin ServiceLogin TCP PortUnassignedReplyCallback-numberCallback-IDUnassignedFramed RouteFramed IPX NetworkStateClassVendor SpecificSession TimeoutIdle TimeoutTermination ActionCalled StationCalling StationNAS IDProxy StateLogin LAT ServiceLogin LAT NodeLogin LAT GroupFramed Appletalk LinkFramed Appltalk NetFramed Appletalk ZoneAccounting StatusAccounting DelayAccounting Input OctetsAccounting Output OctetsAccounting Session IDAccounting AuthenticationAccounting Session TimeAccounting Input PacketsAccounting Output PacketsAccounting Termination CauseAccounting Multilink Session IDAccounting Link CountAccounting Input GigaAccounting Output GigaUnassignedEvent TimestampUnassignedUnassignedUnassignedUnassignedCHAP challengeNAS Port TypePort LimitLogin LAT PortTunnel TypeTunnel MediumTunnel Client EndTunnel Server EndAccounting Tunnel connectTunnel PasswordARAP PasswordARAP FeatureARAP Zone AccesARAP SecurityARAP Security DataPassword RetryPromptConnect InfoConfig TokenEAP MessageMessage AuthenticationTunnel Private GroupTunnel Assigned IDTunnel PreferenceARAP Challenge ResponseAccounting Interim IntervalAccounting Tunnel packets lostNAS Port IDFramed PoolUnassignedTunnel Client Authentication IDTunnel Server Authentication IDUnassignedUnassignedTag %u, Salt %u Tag %u%c|radiusVendor: %s (%u)Unknown Vendor Attribute: %u, Length: %u, Value: %cERROR: length %u != 4Tag[Unused]Tag[%d]%s#%uNAS Select%d%02d secs%02d:%02d min%02d:%02d:%02d hours%dUnnumbered%dNAS assignedTag (Unused) %dTag (%d) %d%d|radius}ERROR: length %u != 4User SelectedNAS Select%s%s|radiusERROR: length %u != 4%.24s|radiusERROR: length %u != 16User_challenge (%02X) User_resp(%02X)ERROR: length %u != 14User can change passwordUser cannot change password, Min password length: %d, created at: %02X, expires in: %02X, Current Time: %02XERROR: length %u != 8%02X|radius} [|radius] %s Attribute (%u), zero-length %s Attribute (%u), length: %u, Value: [|radius] [|radius] [|radius] [|radius]RADIUS, %s (%u), id: 0x%02x length: %uUnknown CommandRADIUS, length: %u %s (%u), id: 0x%02x, Authenticator: Unknown Command%02xip: RequestResponseTrace onTrace offPollPoll Entry AFI: %u: %s, metric: %u Simple Text Authentication data: %s Unknown (%u) Authentication data: AFI: %u AFI: IPv4: %15s/%-2d, tag 0x%04x, metric: %u, next-hop: %sself [|rip] [|rip]%sRIPv%u , %s, length: %uunknown command (%u), routes: %u[|rip] PathResvPathErrResvErrPathTearResvTearResvConfAggregateAcknowledgementHello (Old)RefreshHelloRefresh reduction capableSessionRSVP HopIntegrityTime ValuesError SpecScopeStyleFlowspecFilterSpecSender TemplateSender TSpecAdspecPolicy DataConfirmLabelLabel RequestERORROHelloMessage IDMessage ID AckMessage ID ListRecovery LabelUpstream LabelLabel SetAcceptable Label SetDetourSuggested LabelPropertiesFast Re-RouteSession AttributeCall-IDCall CapabilityRestart CapabilityNotify RequestProtectionAdministrative StatusIPv4IPv6IPv4 plus opt. TLVsIPv6 plus opt. TLVsIPv4IPv6IPv4IPv61obsoleteIntServIntServIntServIPv4IPv6IPv6 Flow-labelTunnel IPv4IPv4IPv6Tunnel IPv4IPv4IPv6Tunnel IPv41Hello RequestHello Ackwithout label rangewith ATM label rangewith FR label rangeGeneralized LabelLabelGeneralized LabelWaveband SwitchingLabelGeneralized LabelWaveband SwitchingLabelGeneralized LabelWaveband SwitchingLabelGeneralized LabelWaveband SwitchingIPv4IPv4IPv4IPv6IPv4 plus opt. TLVsIPv6 plus opt. TLVsIPv4Tunnel IPv4Tunnel IPv4Tunnel IPv41ReservedIPv4 prefixIPv6 prefixAutonomous system numberMPLS label switched path terminationLocal protection availableLocal protection in useBandwidth protectionNode protectionWildcard FilterFixed FilterShared ExplicitDefault/Global InformationGuaranteed ServiceControlled LoadIS hop cntPath b/w estimateMinimum path latencyComposed MTUToken Bucket TSpecGuaranteed Service RSpecEnd-to-end composed value for CEnd-to-end composed value for DSince-last-reshaping point composed CSince-last-reshaping point composed DLocal Protection desiredLabel Recording desiredSE Style desiredBandwidth protection desiredNode protection desiredCosMetric 1Metric 2CCC StatusPath TypeRouting ProblemNotify ErrorBad EXPLICIT_ROUTE objectBad strict nodeBad loose nodeBad initial subobjectNo route available toward destinationUnacceptable label valueRRO indicated routing loopsnon-RSVP-capable router in the pathMPLS label allocation failureUnsupported L3PID Parameter ID: %s (%u), length: %u, Flags: [0x%02x]unknown IS hop count: %u Path b/w estimate: %.10g Mbps Minimum path latency: don't care%u Composed MTU: %u bytes Token Bucket Rate: %.10g Mbps Token Bucket Size: %.10g bytes Peak Data Rate: %.10g Mbps Minimum Policed Unit: %u bytes Maximum Packet Size: %u bytes Rate: %.10g Mbps Slack Term: %u Value: %u RSVP version %u packet not supportedRSVP %s Message, length: %uunknown (%u)RSVP v: %u, msg-type: %s, Flags: [%s], length: %u, ttl: %u, checksum: 0x%04xunknown, type: %unone %s Object (%u) Flags: [%sUnknown %s if unknown], Class-Type: %s (%u), length: %uUnknown IPv4 DestAddress: %s, Protocol ID: 0x%02x Flags: [0x%02x], DestPort %u IPv4 Tunnel EndPoint: %s, Tunnel ID: 0x%04x, Extended Tunnel ID: %s IPv4 Receiver Address: %s IPv4 Notify Node Address: %s Label: %u Generalized Label: %u Waveband ID: %u Start Label: %u, Stop Label: %u Reservation Style: %s, Flags: [0x%02x]Unknown Source Address: %s, Source Port: %u IPv4 Tunnel Sender Address: %s, LSP-ID: 0x%04x L3 Protocol ID: %sUnknown Protocol (0x%04x) L3 Protocol ID: %sUnknown Protocol (0x%04x),%s merge capability Minimum VPI/VCI: %u/%u Maximum VPI/VCI: %u/%u L3 Protocol ID: %sUnknown Protocol (0x%04x) Minimum/Maximum DLCI: %u/%u, %s%s bit DLCI LSP Encoding Type: %s (%u)Unknown Switching Type: %s (%u), Payload ID: %s (0x%04x)UnknownUnknown Subobject Type: %sUnknown %u, %s, %s/%u, Flags: [%s]none Source Instance: 0x%08x, Destination Instance: 0x%08x Restart Time: %ums, Recovery Time: %ums Session Name: Setup Priority: %u, Holding Priority: %u, Flags: [%s]none Previous/Next Interface: %s, Logical Interface Handle: 0x%08x Refresh Period: %ums Msg-Version: %u, length: %u Service Type: %s (%u), break bit %s set, Service length: %uunknown Source Address: %s, Source Port: %u Source Address: %s, LSP-ID: 0x%04x Setup Priority: %u, Holding Priority: %u, Hop-limit: %u, Bandwidth: %.10g Mbps Include Colors: 0x%08x, Exclude Colors: 0x%08x PLR-ID: %s, Avoid-Node-ID: %s Error Node Adress: %s, Flags: [0x%02x] Error Code: %s (%u)unknown, Error Value: %s (%u)unknown, Unknown Error Value (%u) TLV count: %u, padding bytes: %u %s TLV (0x%02x), length: %uunknown packet exceeded snapshotdataackbusyabortackallchallengeresponsedebugparamsversionclient-initreq-acklast-pcktmore-pcktsfree-pcktslow-startjumbogramfetch-datafetch-aclfetch-statusstore-datastore-aclstore-statusremove-filecreate-filerenamesymlinklinkmakedirrmdiroldsetlockoldextlockoldrellockget-statsgive-cbsget-vlinfoget-vlstatsset-vlstatsget-rootvlcheck-tokenget-timenget-vlinfobulk-statsetlockextlockrellockxstat-verget-xstatdfs-lookupdfs-flushcpsdfs-symlinkresidencycallbackinitcbprobegetlockgetcexstatvergetxstatinitcb2whoareyouinitcb3probeuuidgetsrvprefsgetcellservdbgetlocalcellgetcacheconfnew-userwhere-is-itdump-entryadd-to-groupname-to-idid-to-namedeleteremove-from-groupget-cpsnew-entrylist-maxset-maxlist-entrychange-entrylist-elementssame-mbr-ofset-fld-sentrylist-ownedget-cps2get-host-cpsupdate-entrylist-entriescreate-entrydelete-entryget-entry-by-idget-entry-by-nameget-new-volume-idreplace-entryupdate-entrysetlockreleaselocklist-entrylist-attriblinked-listget-statsprobeget-addrschange-addrcreate-entry-nget-entry-by-id-nget-entry-by-name-nreplace-entry-nlist-entry-nlist-attrib-nlinked-list-nupdate-entry-by-namecreate-entry-uget-entry-by-id-uget-entry-by-name-ureplace-entry-ulist-entry-ulist-attrib-ulinked-list-uregaddrget-addrs-ulist-attrib-n2auth-oldauthenticateauthenticate-v2change-pwget-ticket-oldget-ticketset-pwset-fieldscreate-userdelete-userget-entrylist-entryget-statsdebugget-pwget-random-keyunlocklock-statuscreate-volumedelete-volumerestoreforwardend-transcloneset-flagsget-flagstrans-createdumpget-nth-volumeset-forwardingget-nameget-statussig-restorelist-partitionslist-volumesset-id-typesmonitorpartition-inforeclonelist-one-volumenukeset-datex-list-volumesx-list-one-volumeset-infox-list-partitionsforward-multiplecreate-bnodedelete-bnodeset-statusget-statusenumerate-instanceget-instance-infoget-instance-parmadd-superuserdelete-superuserlist-superuserslist-keysadd-keydelete-keyset-cell-nameget-cell-nameget-cell-hostadd-cell-hostdelete-cell-hostset-t-statusshutdown-allrestart-allstartup-allset-noauth-flagre-bozorestartstart-bozo-installuninstallget-datesexecpruneset-restart-timeget-restart-timestart-bozo-logwait-allget-instance-stringsget-restrictedset-restrictedvote-beaconvote-debug-oldvote-sdebug-oldvote-getsyncsitevote-debugvote-sdebugdisk-begindisk-commitdisk-lockdisk-writedisk-getversiondisk-getfiledisk-sendfiledisk-abortdisk-releaselocksdisk-truncatedisk-probedisk-writevdisk-interfaceaddrdisk-setversionexclusiveshareddroppedreadwritewaitread-writeread-onlybackupsalvage volumeno such vnodeno such volumevolume existno servicevolume offlinevoline onlinediskfulldiskquota exceededvolume busyvolume movedAFS IO errorrestarting fileserverack requestedduplicate packetout of sequenceexceeds windowno buffer spacepingping responsedelayidle [|rx] (%d) rx %stype %d cid %08x call# %d seq %d ser %d secindex %d serviceid %hu ,<%s> (%d) fs call %sop#%d fid %d/%d/%d offset %lu length %lu fid %d/%d/%d fid %d/%d/%d StoreStatus date%Y/%m/%d %T %s owner %lu group %lu mode %lo segsize %lu fsync fid %d/%d/%d StoreStatus date%Y/%m/%d %T %s owner %lu group %lu mode %lo segsize %lu fsync offset %lu length %lu flen %lu fid %d/%d/%d fid %d/%d/%d "" StoreStatus date%Y/%m/%d %T %s owner %lu group %lu mode %lo segsize %lu fsync fid %d/%d/%d "" old fid %d/%d/%d "" new fid %d/%d/%d "" fid %d/%d/%d "" link to "" fid %d/%d/%d "" link to fid %d/%d/%d "" volid %lu volname "" fid %d/%d/%d, [|fs] fs reply %sop#%d new fid %d/%d/%d root volume ""%Y/%m/%d %T %s error %s#%d strange fs reply of type %d [|fs]%d %d %n%s %d %n +{ rlidwka}%s %d %n -{ rlidwka} cb call %sop#%d fid %d/%d/%d, ; ver %d expires%Y/%m/%d %T %stype %d afsuuid %08x%04x%04x%02x [|cb] cb reply %sop#%d %08x%04x%04x%02x errcode %d [|cb] pt call %sop#%d "" id %d oldid %d id %d pos %d uid %d gid %d "" ids: %d "" flag %d oid %d id %d gflag %d id %d "" oldid %d newid %d id %d "" [|pt] pt reply %sop#%d ids: %d "" %d maxuid %d maxgid %d errcode %d [|pt] vldb call %sop#%d "" volid %d type %s "" bump %d volid %d type %s "" index %d [|vldb] vldb reply %sop#%d count %d nextindex %d "" numservers %lu servers %s partitions %c %lu rwvol %lu rovol %lu backup %lu newvol %lu count %d nextindex %d "" numservers %lu servers %s partitions %c %lu rwvol %lu rovol %lu backup %lu "" numservers %lu servers afsuuid %08x%04x%04x%02x partitions %c %lu rwvol %lu rovol %lu backup %lu errcode %d [|vldb] kauth call %sop#%d principal "" "" kvno %d domain "" principal "" "" principal "" "" kvno %d name "" [|kauth] kauth reply %sop#%d errcode %d [|kauth] vol call %sop#%d [|vol] vol reply %sop#%d errcode %d [|vol] bos call %sop#%d type "" instance "" "" "" status %d "" num %d %d "" size %d flags %d date %d [|bos] bos reply %sop#%d errcode %d [|bos] ubik call %sop#%d syncsite %s votestart%Y/%m/%d %T %s dbversion %d.%d tid %d.%d site %lu tid %d.%d tid %d.%d file %d pos %d length %dtype %d tid %d.%d file %d pos %d file %d file %d length %d dbversion %d.%d tid %d.%d file %d length %d tid %d.%d oldversion %d.%d newversion %d.%d [|ubik] ubik reply %sop#%d vote no dbversion %d.%d vote yes until%Y/%m/%d %T %s errcode %d [|ubik] bufspace %d maxskew %d first %d serial %d reason %s#%d acked %d,%d-%d-%d nacked %d,%d-%d-%d ifmtu %d maxmtu %d rwind %d maxpackets %d [|ack][|sctp]truncated-sctp - %ld bytes missing!%s.%d > %s.%d: sctp %d) [DATA] (U)(B)(E) [TSN: %u] [SID: %u] [SSEQ %u] [PPID 0x%x] [Payload:bogus chunk length %u]][INIT] [init tag: %u] [rwnd: %u] [OS: %u] [MIS: %u] [init TSN: %u] [INIT ACK] [init tag: %u] [rwnd: %u] [OS: %u] [MIS: %u] [init TSN: %u] [SACK] [cum ack %u] [a_rwnd %u] [#gap acks %u] [#dup tsns %u] [gap ack block #%d: start = %u, end = %u] [dup TSN #%u: %u] [HB REQ] [HB ACK] [ABORT] [SHUTDOWN] [SHUTDOWN ACK] [OP ERR] [COOKIE ECHO] [COOKIE ACK] [ECN ECHO] [ECN CWR] [SHUTDOWN COMPLETE] [FOR CUM TSN] [REL CTRL] [REL CTRL ACK] [Unknown chunk type: 0x%x][|slip]ip v%d[|slip]%02x.%02x: ip %d: utcp %d: : slip-%d!: %s%d W+%d W%dctcp %dctcp * *SA+%d *S+%dU=A+S+I+ %d (%ld)< B M P > ? %s %s %d: [|sll](LLC %s) U-0BooleanIntegerBitstringStringNullObjIDObjectDesU-8U-9U-10U-11U-12U-13U-14U-15SequenceSetIpAddressCounterGaugeTimeTicksOpaqueC-5Counter64GetRequestGetNextRequestGetResponseSetRequestTrapGetBulkInformV2TrapReportnoSuchObjectnoSuchInstanceendOfMibViewP-0noErrortooBignoSuchNamebadValuereadOnlygenErrnoAccesswrongTypewrongLengthwrongEncodingwrongValuenoCreationinconsistentValueresourceUnavailablecommitFailedundoFailedauthorizationErrornotWritableinconsistentNamecoldStartwarmStartlinkDownlinkUpauthenticationFailureegpNeighborLossenterpriseSpecificxxxxxPrimitiveConstructedproteonibmcmuunixacctwgcaymannysernetcisconschpepilogueutennesseebbnxylogicsunisyscanstarwellfleettrwmiteonspartacusexcelanspidernsfnetsytekintergraphinterlanvitalinkulananswcsantacruzoperationxyplexcraybellnorthernresearchdectouchnetworkresearchcorpbaylornmfeccllnlsrisun3comcmcsynopticscheyenneprimemcncchipcomopticaldatasystemsgatedcabletronapollodesktalksystemsssdscastlerockmipstgvsilicongraphicsubcmeritfibercomapplegandalfdartmouthdavidsystemsreutercornelltmaclocusnasaretixboeingattungermannbassdigitalanalysishplanmannetlabsiclauspexlannetncdraycompirellifocomdatabilitynetworkappltechlinknyurndinterconlearningtreewebstercomputerfrontiernokiaallenbradleycernsigmaemergingtechsnmpresearchohiostateultraccurenterprisessnmpInPktssnmpOutPktssnmpInBadVersionssnmpInBadCommunityNamessnmpInBadCommunityUsessnmpInASNParseErrssnmpInBadTypessnmpInTooBigssnmpInNoSuchNamessnmpInBadValuessnmpInReadOnlyssnmpInGenErrssnmpInTotalReqVarssnmpInTotalSetVarssnmpInGetRequestssnmpInGetNextssnmpInSetRequestssnmpInGetResponsessnmpInTrapssnmpOutTooBigssnmpOutNoSuchNamessnmpOutBadValuessnmpOutReadOnlyssnmpOutGenErrssnmpOutGetRequestssnmpOutGetNextssnmpOutSetRequestssnmpOutGetResponsessnmpOutTrapssnmpEnableAuthTrapsegpNeighStateegpNeighAddregpNeighAsegpNeighInMsgsegpNeighInErrsegpNeighOutMsgsegpNeighOutErrsegpNeighInErrMsgsegpNeighOutErrMsgsegpNeighStateUpsegpNeighStateDownsegpNeighIntervalHelloegpNeighIntervalPollegpNeighModeegpNeighEventTriggeregpNeighEntryegpInMsgsegpInErrorsegpOutMsgsegpOutErrorsegpNeighTableegpAsudpLocalAddressudpLocalPortudpEntryudpInDatagramsudpNoPortsudpInErrorsudpOutDatagramsudpTabletcpConnStatetcpConnLocalAddresstcpConnLocalPorttcpConnRemAddresstcpConnRemPorttcpConnEntrytcpRtoAlgorithmtcpRtoMintcpRtoMaxtcpMaxConntcpActiveOpenstcpPassiveOpenstcpAttemptFailstcpEstabResetstcpCurrEstabtcpInSegstcpOutSegstcpRetransSegstcpConnTabletcpInErrstcpOutRstsicmpInMsgsicmpInErrorsicmpInDestUnreachsicmpInTimeExcdsicmpInParmProbsicmpInSrcQuenchsicmpInRedirectsicmpInEchosicmpInEchoRepsicmpInTimestampsicmpInTimestampRepsicmpInAddrMasksicmpInAddrMaskRepsicmpOutMsgsicmpOutErrorsicmpOutDestUnreachsicmpOutTimeExcdsicmpOutParmProbsicmpOutSrcQuenchsicmpOutRedirectsicmpOutEchosicmpOutEchoRepsicmpOutTimestampsicmpOutTimestampRepsicmpOutAddrMasksicmpOutAddrMaskRepsipNetToMediaIfIndexipNetToMediaPhysAddressipNetToMediaNetAddressipNetToMediaTypeipNetToMediaEntryipRouteDestipRouteIfIndexipRouteMetric1ipRouteMetric2ipRouteMetric3ipRouteMetric4ipRouteNextHopipRouteTypeipRouteProtoipRouteAgeipRouteMaskipRouteEntryipAdEntAddripAdEntIfIndexipAdEntNetMaskipAdEntBcastAddripAdEntReasmMaxSizeipAddrEntryipForwardingipDefaultTTLipInReceivesipInHdrErrorsipInAddrErrorsipForwDatagramsipInUnknownProtosipInDiscardsipInDeliversipOutRequestsipOutDiscardsipOutNoRoutesipReasmTimeoutipReasmReqdsipReasmOKsipReasmFailsipFragOKsipFragFailsipFragCreatesipAddrTableipRoutingTableipNetToMediaTableatIfIndexatPhysAddressatNetAddressatEntryatTableifIndexifDescrifTypeifMtuifSpeedifPhysAddressifAdminStatusifOperStatusifLastChangeifInOctetsifInUcastPktsifInNUcastPktsifInDiscardsifInErrorsifInUnknownProtosifOutOctetsifOutUcastPktsifOutNUcastPktsifOutDiscardsifOutErrorsifOutQLenifSpecificifEntryifNumberifTablesysDescrsysObjectIDsysUpTimesysContactsysNamesysLocationsysServicessysteminterfacesatipicmptcpudpegptransmissionsnmpusmMIBCompliancesusmMIBGroupsusmUserEngineIDusmUserNameusmUserSecurityNameusmUserCloneFromusmUserAuthProtocolusmUserAuthKeyChangeusmUserOwnAuthKeyChangeusmUserPrivProtocolusmUserPrivKeyChangeusmUserOwnPrivKeyChangeusmUserPublicusmUserStorageTypeusmUserStatususmUserEntryusmUserSpinLockusmUserTableusmStatsUnsupportedSecLevelsusmStatsNotInTimeWindowsusmStatsUnknownUserNamesusmStatsUnknownEngineIDsusmStatsWrongDigestsusmStatsDecryptionErrorsusmStatsusmUserusmMIBObjectsusmMIBConformancesnmpMPDMIBCompliancessnmpMPDMIBGroupssnmpUnknownSecurityModelssnmpInvalidMsgssnmpUnknownPDUHandlerssnmpMPDStatssnmpMPDAdminsnmpMPDMIBObjectssnmpMPDMIBConformancesnmpEngineIDsnmpEngineBootssnmpEngineTimesnmpEngineMaxMessageSizesnmpEnginesnmpFrameworkAdminsnmpFrameworkMIBObjectssnmpFrameworkMIBConformancesnmpFrameworkMIBsnmpMPDMIBsnmpUsmMIBsnmpModulesmibdirectorymgmtexperimentalprivatesecuritysnmpV2internetdodorgiso+E:+X:+S:+SNMPv1SNMPv2cSNMPv2uSNMPv3[|snmp][nothing to parse][|snmp][Xtagfield?][|snmp][no asnlen][|snmp][asnlen? %d<%d][len%d %s.%s: %d%s.%s > %s.%s: %d %s proc #%u [rpcver %u] %s %u.%u#%u%s > %s: [|tcp]%s.%s > %s.%s: %s > %s: tcp %dtcp_print: calloc [bad hdr length] [bad tcp cksum %x (->%x)!] [tcp sum ok] %u:%u(%u) ack %u win %d urg %dmss %ueolnopwscale %usackOKsack malformed sack sack %d {%u:%u} echo %uechoreply %utimestamp %u %ucc %uccnew %uccecho %uopt-%u:%02x[len %d]: LDP, length: %u[bad opt][|tcp] [RST [!RSTEOFSUSPABORTEORSENOPDMARKBRKIPAOAYTECELGASBWILLWONTDODONTIACBINARYECHORCPSUPPRESS GO AHEADNAMESTATUSTIMING MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND ASCIILOGOUTBYTE MACRODATA ENTRY TERMINALSUPDUPSUPDUP OUTPUTSEND LOCATIONTERMINAL TYPEEND OF RECORDTACACS UIDOUTPUT MARKINGTTYLOC3270 REGIMEX.3 PADNAWSTSPEEDLFLOWLINEMODEXDISPLOCOLD-ENVIRONAUTHENTICATIONENCRYPTNEW-ENVIRONISSENDINFOISSENDREPLYNAMENULLKERBEROS_V4KERBEROS_V5SPXMINKSRPRSASSLLOKISSAKEA_SJKEA_SJ_INTEGDSSNTLMISSUPPORTREPLYSTARTENDREQUEST-STARTREQUEST-ENDEND_KEYIDDEC_KEYIDNULLDES_CFB64DES_OFB64DES3_CFB64DES3_OFB64CAST5_40_CFB64CAST5_40_OFB64CAST128_CFB64CAST128_OFB64%#xIAC IAC%s %s%s %#x %s %s %s %s %s %#x SE%s[|telnet] Telnet: %*s %s ]RRQWRQDATAACKERROREUNDEFENOTFOUNDEACCESSENOSPACEEBADOPEBADIDEEXISTSENOUSER %dtftp-#%d %s " block %d %s tftp-err-#%d "(unknown #%d)ANYADJTIMEACKMASTERREQMASTERACKSETTIMEMASTERUPSLAVEUPELECTIONACCEPTREFUSECONFLICTRESOLVEQUITDATEDATEREQDATEACKTRACEONTRACEOFFMSITEMSITEREQTESTSETDATESETDATEREQLOOP[|timed]TSP_%s(tsp_type %#x) [|timed] vers %d [|timed] seq %d [|timed] hopcnt %d [|timed] time %ld.%06ld [|timed] name %02x %02x %s %s %d: %s %s %d: Non-BroadcastNon-BroadcastNon-BroadcastNon-BroadcastAll-routesAll-routesSingle-routeSingle-routeForwardBackward51615002052447281441140717800??[|token-ring]%s %s [%d:%d]rt = %x:%x (%s) (LLC %s) udp/vt %u %d / %dudp/vat %u c%d %u%s f%d s%drtpv1rtpudp/%s %d c%d %s%s %d %u %u !opt !ext 0x%04x [|rtcp] sr [%d] %u [|rtcp] @%.2f %u %up %ub rr [%d] %u sdes %d %u bye %d %u type-0x%x %d c%d [|rtcp] %u %ul %us %uj @%.2f+%.2f%s > %s: %s.%s > %s.%s: %s > %s: [|udp]truncated-udp %d[|udp]truncated-udplength %dkip [no cksum] [bad udp cksum %x!] [udp sum ok] UDP, length: %uUDP, length: %u(vjc type=IP) (vjc type=raw TCP) (vjc type=compressed TCP) %c C=0x%02x sum=0x%04x (vjc type=error) (vjc type=0x%02x) Advertisementnonesimpleahunknown type (%u)VRRPv%u, %s, (ttl %u), vrid %u, prio %u, authtype %s, intvl %us, length %u, (bad vrrp cksum %x), addrs(%d):%c%s auth ""[|vrrp] wb-id: %u/%s:%u (max %u/%s:%u) %c%s:%u> wb-rreq: please repair %s %s:%u<%u:%u> wb-preq: need %u/%s:%u wb-prep: %u/%s:%u%c%s:%u>dop-0!dop-1!RECTLINEMLDELXFORMELLCHARSTRNOPPSCODEPSCOMPREFSKIPHOLE < dop-%d! %s%d[|][|wb] > wb-rrep: for %s %s:%u<%u:%u> wb-dop: %s:%u<%u:%u>[|wb]* wb-kill wb-%d!unsafeunackedackedhm-ackhm-ctlserv-ackserv-nakclient-ackstat*<%s,%s,%s>ZEPH [|zephyr] (%d) zephyr0.2 v%s %stype %dSENT/%s %sUSER_LOCATEUSER_HIDE hideUSER_UNHIDE unhide locate %sZEPHYR_ADMIN zephyr-admin %sZEPHYR_CTLCLIENTSUBSCRIBESUBSCRIBE_NODEFSUNSUBSCRIBE %ssub%sSUBSCRIBESUBSCRIBE_NODEFS %sGIMME retGIMMEDEFS gimme-defsCLEARSUB clear-subs %sHM %sREALMADD_SUBSCRIBE realm add-subsREQ_SUBSCRIBE realm req-subsRLM_SUBSCRIBE realm rlm-subRLM_UNSUBSCRIBE realm rlm-unsubHM_CTL hm_ctl %s %sHM_STATHMST_CLIENTGIMMESTATS get-client-statsWG_CTL wg_ctl %s %sLOGINUSER_FLUSH flush_locsNONEOPSTAFFREALM-VISIBLEREALM-ANNOUNCEDNET-VISIBLENET-ANNOUNCED set-exposure %s* to %s op %s%sNo data link types.Data link types (use option -y to set): %s (%s) (not supported) DLT %d (not supported) %saAc:C:dDeE:fF:i:lLm:nNOpqr:Rs:StT:uUvw:xXy:Yinvalid packet count %sinvalid file size %s%s%d.%s (%s) crypto code not compiled inInvalid adapter indexInvalid adapter index%sInvalid adapter index%s: ignoring option `-m %s' (no libsmi support) invalid snaplen %svatwbrpcrtprtcpsnmpcnfptftpaodvunknown packet type `%s'invalid data link type %saAc:C:dDeE:fF:i:lLm:nNOpqr:Rs:StT:uUvw:xXy:Y%sreading from file %s, link-type %u reading from file %s, link-type %s (%s) -f and -r options are incompatible%s%s%s%s%s: data link type %s snaplen raised from %d to %d%s%s%s%sunsupported data link type %sunsupported data link type %d%s: verbose output suppressed, use -v or -vv for full protocol decode %s: listening on %s, link-type %u, capture size %u bytes listening on %s, link-type %s (%s), capture size %u bytes %s: pcap_loop: %s pcap_stats: %s %s: %u packets captured, %d packets received by filter, %d packets dropped by kernel too many output filesdump_packet_and_trunc: malloc%s %s version %s %s Usage: %s [-aAdDeflLnNOpqRStuUvxX] [-c count] [ -C file_size ] [ -E algo:secret ] [ -F file ] [ -i interface ] [ -r file ] [ -s snaplen ] [ -T type ] [ -w file ] [ -y datalinktype ] [ expression ] %02d:%02d:%02d.%06u %u.%06u 000000 %d. %06d Date fail %04d-%02d-%02d %02d:%02d:%02d.%06u ywdhms0s-%d%s#%d%s, #%d#%d%s: %s: WARNING: copy_argv: malloccan't open %s: %scan't stat %s: %smalloc(%d) for %s: %sread %s: %sshort read %s (%d != %d)%c\%03oAttribute=[A] SearchCount=[d] Flags=[w] Level=[dP5] File=[S] Handle=[w] Count=[d] EOS=[w] Eoffset=[d] LastNameOfs=[w] data: InfoLevel=[d] idFileSystem=[W] SectorUnit=[D] Unit=[D] Avail=[D] SectorSize=[d] CreationTime=[T2]VolNameLength=[B] VolumeLabel=[s12] Capabilities=[W] MaxFileLen=[D] VolNameLen=[D] Volume=[S] UnknownLevel data: [|SMB]TRANSACT2_OPENFlags2=[w] Mode=[w] SearchAttrib=[A] Attrib=[A] Time=[T2] OFun=[w] Size=[D] Res=([w, w, w, w, w]) Path=[S]Handle=[d] Attrib=[A] Time=[T2] Size=[D] Access=[w] Type=[w] State=[w] Action=[w] Inode=[W] OffErr=[d] |EALength=[d] TRANSACT2_FINDFIRSTTRANSACT2_FINDNEXTTRANSACT2_QFSINFOTRANSACT2_SETFSINFOTRANSACT2_QPATHINFOTRANSACT2_SETPATHINFOTRANSACT2_QFILEINFOTRANSACT2_SETFILEINFOTRANSACT2_FSCTLTRANSACT2_IOCTLTRANSACT2_FINDNOTIFYFIRSTTRANSACT2_FINDNOTIFYNEXTTRANSACT2_MKDIR%s Trans2Interim %s param_length=%d data_length=%d Trans2Secondary TotParam=[d] TotData=[d] ParamCnt=[d] ParamOff=[d] ParamDisp=[d] DataCnt=[d] DataOff=[d] DataDisp=[d] Handle=[d] TotParam=[d] TotData=[d] MaxParam=[d] MaxData=[d] MaxSetup=[d] Flags=[w] TimeOut=[D] Res1=[w] ParamCnt=[d] ParamOff=[d] DataCnt=[d] DataOff=[d] SetupCnt=[d] TransactionName=[S] %TotParam=[d] TotData=[d] Res1=[w] ParamCnt=[d] ParamOff=[d] ParamDisp[d] DataCnt=[d] DataOff=[d] DataDisp=[d] SetupCnt=[d] [|SMB]BROWSE PACKET |Param BROWSE PACKET: Type=[B] (LocalMasterAnnouncement) UpdateCount=[w] Res1=[B] AnnounceInterval=[d] Name=[n2] MajorVersion=[B] MinorVersion=[B] ServerType=[W] ElectionVersion=[w] BrowserConstant=[w] BROWSE PACKET: Type=[B] (HostAnnouncement) UpdateCount=[w] Res1=[B] AnnounceInterval=[d] Name=[n2] MajorVersion=[B] MinorVersion=[B] ServerType=[W] ElectionVersion=[w] BrowserConstant=[w] BROWSE PACKET: Type=[B] (AnnouncementRequest) Flags=[B] ReplySystemName=[S] BROWSE PACKET: Type=[B] (WorkgroupAnnouncement) UpdateCount=[w] Res1=[B] AnnounceInterval=[d] Name=[n2] MajorVersion=[B] MinorVersion=[B] ServerType=[W] CommentPointer=[W] ServerName=[S] BROWSE PACKET: Type=[B] (ElectionFrame) ElectionVersion=[B] OSSummary=[W] Uptime=[(W, W)] ServerName=[S] BROWSE PACKET: Type=[B] (BecomeBackupBrowser) Name=[S] BROWSE PACKET: Type=[B] (GetBackupList) ListCount?=[B] Token?=[B] BROWSE PACKET: Type=[B] (BackupListResponse) ServerCount?=[B] Token?=[B]*Name=[S] BROWSE PACKET: Type=[B] (MasterAnnouncement) MasterName=[S] BROWSE PACKET: Type=[B] (ResetBrowser) Options=[B] Unknown Browser Frame [|SMB]Command=[w] Str1=[S] Str2=[S] IPC TotParamCnt=[d] TotDataCnt=[d] MaxParmCnt=[d] MaxDataCnt=[d] MaxSCnt=[d] TransFlags=[w] Res1=[w] Res2=[w] Res3=[w] ParamCnt=[d] ParamOff=[d] DataCnt=[d] DataOff=[d] SUCnt=[d] |Name=[S] |Param |Data TotParamCnt=[d] TotDataCnt=[d] Res1=[d] ParamCnt=[d] ParamOff=[d] Res2=[d] DataCnt=[d] DataOff=[d] Res3=[d] Lsetup=[d] |Unknown |Param |Data \MAILSLOT\BROWSE\PIPE\LANMAN[|SMB]*|Dialect=[Z] Core Protocol DialectIndex=[d]NT1 Protocol DialectIndex=[d] SecMode=[B] MaxMux=[d] NumVcs=[d] MaxBuffer=[D] RawSize=[D] SessionKey=[W] Capabilities=[W] ServerTime=[T3]TimeZone=[d] CryptKey=Coreplus/Lanman1/Lanman2 Protocol DialectIndex=[d] SecMode=[w] MaxXMit=[d] MaxMux=[d] MaxVcs=[d] BlkMode=[w] SessionKey=[W] ServerTime=[T1]TimeZone=[d] Res=[W] CryptKey=[|SMB]Com2=[w] Off2=[d] BufSize=[d] MpxMax=[d] VcNum=[d] SessionKey=[W] PassLen=[d] CryptLen=[d] CryptOff=[d] Pass&Name= Com2=[B] Res1=[B] Off2=[d] MaxBuffer=[d] MaxMpx=[d] VcNumber=[d] SessionKey=[W] CaseInsensitivePasswordLength=[d] CaseSensitivePasswordLength=[d] Res=[W] Capabilities=[W] Pass1&Pass2&Account&Domain&OS&LanMan= Com2=[w] Off2=[d] Action=[w] Com2=[B] Res=[B] Off2=[d] Action=[w] NativeOS=[S] NativeLanMan=[S] PrimaryDomain=[S] [|SMB]SMBunknownSMBtconPath=[Z] Password=[Z] Device=[Z] MaxXmit=[d] TreeId=[d] SMBtdisSMBexitSMBioctlSMBechoReverbCount=[d] SequenceNum=[d] SMBulogoffXSMBgetatrPath=[Z] Attribute=[A] Time=[T2]Size=[D] Res=([w,w,w,w,w]) SMBsetatrAttribute=[A] Time=[T2]Res=([w,w,w,w,w]) Path=[Z] SMBchkpthPath=[Z] SMBsearchCount=[d] Attrib=[A] Path=[Z] BlkType=[B] BlkLen=[d] |Res1=[B] Mask=[s11] Srv1=[B] DirIndex=[d] Srv2=[w] Res2=[W] Count=[d] BlkType=[B] BlkLen=[d] * Res1=[B] Mask=[s11] Srv1=[B] DirIndex=[d] Srv2=[w] Res2=[W] Attrib=[a] Time=[T1]Size=[D] Name=[s13] SMBopenMode=[w] Attribute=[A] Path=[Z] Handle=[d] OAttrib=[A] Time=[T2]Size=[D] Access=[w] SMBcreateAttrib=[A] Time=[T2]Path=[Z] Handle=[d] SMBmknewAttrib=[A] Time=[T2]Path=[Z] Handle=[d] SMBunlinkAttrib=[A] Path=[Z] SMBreadHandle=[d] ByteCount=[d] Offset=[D] CountLeft=[d] Count=[d] Res=([w,w,w,w]) SMBwriteHandle=[d] ByteCount=[d] Offset=[D] CountLeft=[d] Count=[d] SMBcloseHandle=[d] Time=[T2]SMBmkdirPath=[Z] SMBrmdirP